Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282318_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human gastric cancer using PRMT7 antibody at dilution of 1:200 (40x lens).)

Rabbit anti-Human PRMT7 Polyclonal Antibody | anti-PRMT7 antibody

PRMT7 Rabbit pAb

Gene Names
SRI; SCN; V19; CP22; CP-22
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
PRMT7, Antibody; PRMT7 Rabbit pAb; PRMT7; SBIDDS; anti-PRMT7 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
Applicable Applications for anti-PRMT7 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 513-692 of human PRMT7 (NP_061896.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded human gastric cancer using PRMT7 antibody at dilution of 1:200 (40x lens).)

product-image-AAA282318_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human gastric cancer using PRMT7 antibody at dilution of 1:200 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human stomach using PRMT7 antibody at dilution of 1:200 (40x lens).)

product-image-AAA282318_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human stomach using PRMT7 antibody at dilution of 1:200 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human breast cancer using PRMT7 antibody at dilution of 1:200 (40x lens).)

product-image-AAA282318_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human breast cancer using PRMT7 antibody at dilution of 1:200 (40x lens).)
Related Product Information for anti-PRMT7 antibody
Arginine methylation is an apparently irreversible protein modification catalyzed by arginine methyltransferases, such as PMT7, using S-adenosylmethionine (AdoMet) as the methyl donor. Arginine methylation is implicated in signal transduction, RNA transport, and RNA splicing (Miranda et al., 2004 [PubMed 15044439]).
Product Categories/Family for anti-PRMT7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,006 Da
NCBI Official Full Name
sorcin isoform C
NCBI Official Synonym Full Names
sorcin
NCBI Official Symbol
SRI
NCBI Official Synonym Symbols
SCN; V19; CP22; CP-22
NCBI Protein Information
sorcin; 22 kDa protein; H_RG167B05.1; calcium binding protein amplified in mutlidrug-resistant cells
UniProt Protein Name
Sorcin
UniProt Gene Name
SRI
UniProt Synonym Gene Names
CP22
UniProt Entry Name
SORCN_HUMAN

Similar Products

Product Notes

The PRMT7 sri (Catalog #AAA282318) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRMT7 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRMT7 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PRMT7 sri for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAYPGHPGAG GGYYPGGYGG APGGPAFPGQ TQDPLYGYFA AVAGQDGQID ADELQRCLTQ SGIAGGYKPF NLETCRLMVS MLDRDMSGTM GFNEFKELWA VLNGWRQHFI SFDTDRSGTV DPQELQKALT TMGFRLSPQA VNSIAKRYST NGKITFDDYI ACCVKLRALT DSFRRRDTAQ QGVVNFPYDD FIQCVMSV. It is sometimes possible for the material contained within the vial of "PRMT7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.