Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200540_WB11.jpg WB (Western Blot) (WB Suggested Anti-PROS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Rabbit PROS1 Polyclonal Antibody | anti-PROS1 antibody

PROS1 antibody - middle region

Gene Names
PROS1; PSA; PROS; PS21; PS22; PS23; PS24; PS25; THPH5; THPH6
Reactivity
Tested: Human, Mouse
Predicted: Cow, Dog, Guinea Pig, Horse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PROS1, Antibody; PROS1 antibody - middle region; anti-PROS1 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human, Mouse
Predicted: Cow, Dog, Guinea Pig, Horse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL
Sequence Length
676
Applicable Applications for anti-PROS1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 86%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PROS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PROS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

product-image-AAA200540_WB11.jpg WB (Western Blot) (WB Suggested Anti-PROS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

WB (Western Blot)

(Host: RabbitTarget Name: PROS1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

product-image-AAA200540_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: PROS1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Immunohistochemistry with Liver tissue at an antibody concentration of 5ug/ml using anti-PROS1 antibody)

product-image-AAA200540_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Liver tissue at an antibody concentration of 5ug/ml using anti-PROS1 antibody)
Related Product Information for anti-PROS1 antibody
This is a rabbit polyclonal antibody against PROS1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PROS1 is an anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
vitamin K-dependent protein S isoform 2 preproprotein
NCBI Official Synonym Full Names
protein S
NCBI Official Symbol
PROS1
NCBI Official Synonym Symbols
PSA; PROS; PS21; PS22; PS23; PS24; PS25; THPH5; THPH6
NCBI Protein Information
vitamin K-dependent protein S
UniProt Protein Name
Vitamin K-dependent protein S
UniProt Gene Name
PROS1
UniProt Synonym Gene Names
PROS
UniProt Entry Name
PROS_HUMAN

Similar Products

Product Notes

The PROS1 pros1 (Catalog #AAA200540) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PROS1 antibody - middle region reacts with Tested: Human, Mouse Predicted: Cow, Dog, Guinea Pig, Horse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PROS1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PROS1 pros1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MCAQLCVNYP GGYTCYCDGK KGFKLAQDQK SCEVVSVCLP LNLDTKYELL. It is sometimes possible for the material contained within the vial of "PROS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.