Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-PRPSAP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:100Positive Control: HepG2 cell lysate)

Rabbit PRPSAP2 Polyclonal Antibody | anti-PRPSAP2 antibody

PRPSAP2 Antibody - N-terminal region

Gene Names
PRPSAP2; PAP41
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRPSAP2, Antibody; PRPSAP2 Antibody - N-terminal region; anti-PRPSAP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQ
Sequence Length
369
Applicable Applications for anti-PRPSAP2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PRPSAP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PRPSAP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:100Positive Control: HepG2 cell lysate)

WB (Western Blot) (WB Suggested Anti-PRPSAP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:100Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: PRPSAP2Sample Type: MCF7Antibody Dilution: 1.0ug/mlPRPSAP2 is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot) (Host: RabbitTarget Name: PRPSAP2Sample Type: MCF7Antibody Dilution: 1.0ug/mlPRPSAP2 is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: PRPSAP2Sample Type: JurkatAntibody Dilution: 1.0ug/mlPRPSAP2 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot) (Host: RabbitTarget Name: PRPSAP2Sample Type: JurkatAntibody Dilution: 1.0ug/mlPRPSAP2 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: PRPSAP2Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: PRPSAP2Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PRPSAP2Sample Type: HelaAntibody Dilution: 1.0ug/mlPRPSAP2 is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot) (Host: RabbitTarget Name: PRPSAP2Sample Type: HelaAntibody Dilution: 1.0ug/mlPRPSAP2 is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: PRPSAP2Sample Type: Hela Whole Cell lysatesAntibody Dilution: 2.0ug/mlPRPSAP2 is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot) (Host: RabbitTarget Name: PRPSAP2Sample Type: Hela Whole Cell lysatesAntibody Dilution: 2.0ug/mlPRPSAP2 is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: PRPSAP2Sample Type: 721_BAntibody Dilution: 1.0ug/mlPRPSAP2 is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot) (Host: RabbitTarget Name: PRPSAP2Sample Type: 721_BAntibody Dilution: 1.0ug/mlPRPSAP2 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-PRPSAP2 antibody
This is a rabbit polyclonal antibody against PRPSAP2. It was validated on Western Blot

Target Description: The enzyme phosphoribosylpyrophosphate synthetase (PRS) catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalytic subunits and two associated subunits. This gene encodes a non-catalytic associated subunit of PRS.
Product Categories/Family for anti-PRPSAP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
phosphoribosyl pyrophosphate synthase-associated protein 2 isoform 1
NCBI Official Synonym Full Names
phosphoribosyl pyrophosphate synthetase associated protein 2
NCBI Official Symbol
PRPSAP2
NCBI Official Synonym Symbols
PAP41
NCBI Protein Information
phosphoribosyl pyrophosphate synthase-associated protein 2
UniProt Protein Name
Phosphoribosyl pyrophosphate synthase-associated protein 2
UniProt Gene Name
PRPSAP2
UniProt Synonym Gene Names
PRPP synthase-associated protein 2; PAP41

Similar Products

Product Notes

The PRPSAP2 prpsap2 (Catalog #AAA23567) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRPSAP2 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PRPSAP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRPSAP2 prpsap2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MFCVTPPELE TKMNITKGGL VLFSANSNSS CMELSKKIAE RLGVEMGKVQ. It is sometimes possible for the material contained within the vial of "PRPSAP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.