Rabbit PRR7 Polyclonal Antibody | anti-PRR7 antibody
PRR7 antibody - middle region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PRR7, Antibody; PRR7 antibody - middle region; anti-PRR7 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRG
Sequence Length
274
Applicable Applications for anti-PRR7 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PRR7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-PRR7 antibody
This is a rabbit polyclonal antibody against PRR7. It was validated on Western Blot and immunohistochemistry
Target Description: PRR7 encodes a proline-rich membrane protein which is involved in modulating neural activities via interactions with the NMDA receptor and PSD-95, and PSD core formation.
Target Description: PRR7 encodes a proline-rich membrane protein which is involved in modulating neural activities via interactions with the NMDA receptor and PSD-95, and PSD core formation.
Product Categories/Family for anti-PRR7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31kDa
NCBI Official Full Name
proline-rich protein 7
NCBI Official Synonym Full Names
proline rich 7, synaptic
NCBI Official Symbol
PRR7
NCBI Protein Information
proline-rich protein 7
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The PRR7 (Catalog #AAA197870) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRR7 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRR7 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PRR7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AEPPPPYSEV LTDTRGLYRK IVTPFLSRRD SAEKQEQPPP SYKPLFLDRG. It is sometimes possible for the material contained within the vial of "PRR7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
