Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281658_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using PRSS8 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit PRSS8 Polyclonal Antibody | anti-PRSS8 antibody

PRSS8 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
PRSS8; CAP1; PROSTASIN
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
PRSS8, Antibody; PRSS8 Rabbit pAb; PRSS8; CAP1; PROSTASIN; prostasin; anti-PRSS8 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
TCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLRPILFLPLGLALGLLSPWLSEH
Applicable Applications for anti-PRSS8 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human PRSS8 (NP_002764.1).
Cellular Location
Cell membrane, Secreted, Single-pass membrane protein, extracellular space, extracellular space
Positive Samples
Mouse kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using PRSS8 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281658_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using PRSS8 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of Mouse kidney, using PRSS8 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA281658_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of Mouse kidney, using PRSS8 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-PRSS8 antibody
Background: This gene encodes a member of the peptidase S1 or chymotrypsin family of serine proteases. The encoded preproprotein is proteolytically processed to generate light and heavy chains that associate via a disulfide bond to form the heterodimeric enzyme. This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid. This protease exhibits trypsin-like substrate specificity, cleaving protein substrates at the carboxyl terminus of lysine or arginine residues. The encoded protease partially mediates proteolytic activation of the epithelial sodium channel, a regulator of sodium balance, and may also play a role in epithelial barrier formation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
36,431 Da
NCBI Official Full Name
protease, serine, 8 (prostasin), isoform CRA_b, partial
NCBI Official Synonym Full Names
protease, serine, 8
NCBI Official Symbol
PRSS8
NCBI Official Synonym Symbols
CAP1; PROSTASIN
NCBI Protein Information
prostasin; serine protease 8; channel-activating protease 1
UniProt Protein Name
Prostasin
UniProt Gene Name
PRSS8
UniProt Synonym Gene Names
CAP1
UniProt Entry Name
PRSS8_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PRSS8 prss8 (Catalog #AAA281658) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRSS8 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRSS8 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PRSS8 prss8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TCNCLYNIDA KPEEPHFVQE DMVCAGYVEG GKDACQGDSG GPLSCPVEGL WYLTGIVSWG DACGARNRPG VYTLASSYAS WIQSKVTELQ PRVVPQTQES QPDSNLCGSH LAFSSAPAQG LLRPILFLPL GLALGLLSPW LSEH. It is sometimes possible for the material contained within the vial of "PRSS8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.