Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198263_WB10.jpg WB (Western Blot) (WB Suggested Anti-PSMC5 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Rabbit PSMC5 Polyclonal Antibody | anti-PSMC5 antibody

PSMC5 antibody - C-terminal region

Gene Names
PSMC5; S8; p45; SUG1; SUG-1; TBP10; TRIP1; p45/SUG
Reactivity
Human , Mouse
Predicted Species Reactivity:Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunoprecipitation, Immunohistochemistry
Purity
Protein A purified
Synonyms
PSMC5, Antibody; PSMC5 antibody - C-terminal region; anti-PSMC5 antibody
Ordering
Host
Rabbit
Reactivity
Human , Mouse
Predicted Species Reactivity:Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
Sequence Length
406
Applicable Applications for anti-PSMC5 antibody
WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PSMC5
Protein Size (# AA)
406 amino acids
Subunit
8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PSMC5 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

product-image-AAA198263_WB10.jpg WB (Western Blot) (WB Suggested Anti-PSMC5 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Sample Type: Mouse BrainSample Type:4. rat brain extract(80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)

product-image-AAA198263_WB11.jpg WB (Western Blot) (Sample Type: Mouse BrainSample Type:4. rat brain extract(80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)

IP (Immunoprecipitation)

(Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :PSMC5Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :PSMC5Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

product-image-AAA198263_IP13.jpg IP (Immunoprecipitation) (Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :PSMC5Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :PSMC5Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

IHC (Immunohistochemistry)

(Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :PSMC5: Red DAPI:BlueGene Name :PSMC5Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

product-image-AAA198263_IHC15.jpg IHC (Immunohistochemistry) (Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :PSMC5: Red DAPI:BlueGene Name :PSMC5Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)
Related Product Information for anti-PSMC5 antibody
This is a rabbit polyclonal antibody against PSMC5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits.PSMC5 is one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. In addition to participation in proteasome functions, this subunit may participate in transcriptional regulation since it has been shown to interact with the thyroid hormone receptor and retinoid X receptor-alpha.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
26S proteasome regulatory subunit 8 isoform 1
NCBI Official Synonym Full Names
proteasome 26S subunit, ATPase 5
NCBI Official Symbol
PSMC5
NCBI Official Synonym Symbols
S8; p45; SUG1; SUG-1; TBP10; TRIP1; p45/SUG
NCBI Protein Information
26S proteasome regulatory subunit 8
UniProt Protein Name
26S protease regulatory subunit 8
UniProt Gene Name
PSMC5
UniProt Synonym Gene Names
SUG1; TRIP1
UniProt Entry Name
PRS8_HUMAN

Similar Products

Product Notes

The PSMC5 psmc5 (Catalog #AAA198263) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PSMC5 antibody - C-terminal region reacts with Human, Mouse
Predicted Species Reactivity:Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PSMC5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PSMC5 psmc5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AEVKGVCTEA GMYALRERRV HVTQEDFEMA VAKVMQKDSE KNMSIKKLWK. It is sometimes possible for the material contained within the vial of "PSMC5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.