WB (Western Blot)
(WB Suggested Anti-PTDSS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysate)
Rabbit PTDSS2 Polyclonal Antibody | anti-PTDSS2 antibody
PTDSS2 antibody - middle region
Gene Names
PTDSS2; PSS2
Reactivity
Tested Species Reactivity: Human (Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Rat)
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PTDSS2, Antibody; PTDSS2 antibody - middle region; anti-PTDSS2 antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human (Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Rat)
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: QAWLVAAITATELLIVVKYDPHTLTLSLPFYISQCWTLGSVLALTWTVWR
Sequence Length
487
Applicable Applications for anti-PTDSS2 antibody
WB (Western Blot)
Homology
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PTDSS2
Protein Size
487 amino acids
Protein Interactions
HNRNPR; ILF3; UBC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-PTDSS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysate)
WB (Western Blot)
(WB Suggested Anti-PTDSS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysate)
Related Product Information for anti-PTDSS2 antibody
This is a rabbit polyclonal antibody against PTDSS2. It was validated on Western Blot
Target Description: Phosphatidylserine (PS) accounts for 5 to 10% of cell membrane phospholipids. In addition to its role as a structural component, PS is involved in cell signaling, blood coagulation, and apoptosis. PS is synthesized by a calcium-dependent base-exchange reaction catalyzed by PS synthases (EC 2.7.8.8), like PTDSS2, that exchange L-serine for the polar head group of phosphatidylcholine (PC) or phosphatidylethanolamine (PE) (Sturbois-Balcerzak et al., 2001 [PubMed 11084049]).
Target Description: Phosphatidylserine (PS) accounts for 5 to 10% of cell membrane phospholipids. In addition to its role as a structural component, PS is involved in cell signaling, blood coagulation, and apoptosis. PS is synthesized by a calcium-dependent base-exchange reaction catalyzed by PS synthases (EC 2.7.8.8), like PTDSS2, that exchange L-serine for the polar head group of phosphatidylcholine (PC) or phosphatidylethanolamine (PE) (Sturbois-Balcerzak et al., 2001 [PubMed 11084049]).
Product Categories/Family for anti-PTDSS2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
phosphatidylserine synthase 2 isoform 2
NCBI Official Synonym Full Names
phosphatidylserine synthase 2
NCBI Official Symbol
PTDSS2
NCBI Official Synonym Symbols
PSS2
NCBI Protein Information
phosphatidylserine synthase 2
UniProt Protein Name
Phosphatidylserine synthase 2
UniProt Gene Name
PTDSS2
UniProt Synonym Gene Names
PSS2; PSS-2; PtdSer synthase 2
Similar Products
Product Notes
The PTDSS2 ptdss2 (Catalog #AAA200055) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTDSS2 antibody - middle region reacts with Tested Species Reactivity: Human (Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Rat) and may cross-react with other species as described in the data sheet. AAA Biotech's PTDSS2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PTDSS2 ptdss2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QAWLVAAITA TELLIVVKYD PHTLTLSLPF YISQCWTLGS VLALTWTVWR. It is sometimes possible for the material contained within the vial of "PTDSS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.