Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201153_WB13.jpg WB (Western Blot) (WB Suggested Anti-PVR AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit anti-Human PVR Polyclonal Antibody | anti-PVR antibody

PVR antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
PVR; PVS; HVED; CD155; NECL5; TAGE4; Necl-5
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PVR, Antibody; PVR antibody - N-terminal region; anti-PVR antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVT
Sequence Length
417
Applicable Applications for anti-PVR antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PVR AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

product-image-AAA201153_WB13.jpg WB (Western Blot) (WB Suggested Anti-PVR AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

IHC (Immunohistochemistry)

(Researcher: Dr. Fabio D'Amico, University of CataniaApplication: IHCSpecies+tissue/cell type:Human KeratinocytesPrimary antibody dilution: 1:200Secondary antibody: Anti-rabbit Dylight 488Secondary antibody dilution:1:500)

product-image-AAA201153_IHC15.jpg IHC (Immunohistochemistry) (Researcher: Dr. Fabio D'Amico, University of CataniaApplication: IHCSpecies+tissue/cell type:Human KeratinocytesPrimary antibody dilution: 1:200Secondary antibody: Anti-rabbit Dylight 488Secondary antibody dilution:1:500)
Related Product Information for anti-PVR antibody
This is a rabbit polyclonal antibody against PVR. It was validated on Western Blot

Target Description: The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-PVR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
poliovirus receptor isoform alpha
NCBI Official Synonym Full Names
poliovirus receptor
NCBI Official Symbol
PVR
NCBI Official Synonym Symbols
PVS; HVED; CD155; NECL5; TAGE4; Necl-5
NCBI Protein Information
poliovirus receptor
UniProt Protein Name
Poliovirus receptor
UniProt Gene Name
PVR
UniProt Synonym Gene Names
PVS; NECL-5
UniProt Entry Name
PVR_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PVR pvr (Catalog #AAA201153) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PVR antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PVR can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PVR pvr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FHQTQGPSYS ESKRLEFVAA RLGAELRNAS LRMFGLRVED EGNYTCLFVT. It is sometimes possible for the material contained within the vial of "PVR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.