Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23570_WB8.jpg WB (Western Blot) (WB Suggested Anti-RAB1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Rabbit RAB1A Polyclonal Antibody | anti-RAB1A antibody

RAB1A antibody - middle region

Gene Names
RAB1A; RAB1; YPT1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
RAB1A, Antibody; RAB1A antibody - middle region; anti-RAB1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC
Sequence Length
205
Applicable Applications for anti-RAB1A antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RAB1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RAB1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

product-image-AAA23570_WB8.jpg WB (Western Blot) (WB Suggested Anti-RAB1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

WB (Western Blot)

(Host: RabbitTarget Name: RAB1ASample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2ug/mlPeptide Concentration: 5.0 ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 12%RAB1A is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

product-image-AAA23570_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: RAB1ASample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2ug/mlPeptide Concentration: 5.0 ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 12%RAB1A is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

WB (Western Blot)

(Host: RabbitTarget Name: RAB1ASample Type: HepG2Antibody Dilution: 1.0ug/ml)

product-image-AAA23570_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: RAB1ASample Type: HepG2Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: RAB1ASample Type: 293T Whole Cell lysatesAntibody Dilution: 0.2ug/ml)

product-image-AAA23570_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: RAB1ASample Type: 293T Whole Cell lysatesAntibody Dilution: 0.2ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: RAB1ASample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

product-image-AAA23570_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: RAB1ASample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: RAB1ASample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

product-image-AAA23570_WB3.jpg WB (Western Blot) (Host: MouseTarget Name: RAB1ASample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Sample Type: Human, MouseSample Type: 1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)3. Human Cervical Cancer Cell transfected with Rab1A-GFP (15ug)Primary Dilution: 1:1000Secondary Antibody: goat anti-RabbitSecondary Dilution: 1:40,000Image Submitted by:  Dr. Jakob Szwedo, Dr. Lupashin's LabUniversity of Arkansas for Medical SciencesSee Customer Feedback tab for detailed information.)

product-image-AAA23570_WB2.jpg WB (Western Blot) (Sample Type: Human, MouseSample Type: 1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)3. Human Cervical Cancer Cell transfected with Rab1A-GFP (15ug)Primary Dilution: 1:1000Secondary Antibody: goat anti-RabbitSecondary Dilution: 1:40,000Image Submitted by:  Dr. Jakob Szwedo, Dr. Lupashin's LabUniversity of Arkansas for Medical SciencesSee Customer Feedback tab for detailed information.)

IHC (Immunohistochemistry)

(Rabbit Anti-RAB1A AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: Cytoplasmic in excellent stainingPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA23570_IHC.jpg IHC (Immunohistochemistry) (Rabbit Anti-RAB1A AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: Cytoplasmic in excellent stainingPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-RAB1A antibody
This is a rabbit polyclonal antibody against RAB1A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multipl
Product Categories/Family for anti-RAB1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
Ras-related protein Rab-1A
NCBI Official Synonym Full Names
RAB1A, member RAS oncogene family
NCBI Official Symbol
RAB1A
NCBI Official Synonym Symbols
RAB1; YPT1
NCBI Protein Information
ras-related protein Rab-1A
UniProt Protein Name
Ras-related protein Rab-1A
UniProt Gene Name
RAB1A
UniProt Synonym Gene Names
RAB1
UniProt Entry Name
RAB1A_HUMAN

Similar Products

Product Notes

The RAB1A rab1a (Catalog #AAA23570) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB1A antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RAB1A can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the RAB1A rab1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AKNATNVEQS FMTMAAEIKK RMGPGATAGG AEKSNVKIQS TPVKQSGGGC. It is sometimes possible for the material contained within the vial of "RAB1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.