WB (Western Blot)
(WB Suggested Anti-Rab27b AntibodyTitration: 0.5 ug/mlPositive Control: human testis, mouse liver, brain and testis)
Rabbit Rab27b Polyclonal Antibody | anti-RAB27B antibody
Rab27b antibody - C-terminal region
Gene Names
Rab27b; 2310021G14Rik; B130064M09Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Rab27b, Antibody; Rab27b antibody - C-terminal region; anti-RAB27B antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVE
Sequence Length
218
Applicable Applications for anti-RAB27B antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-Rab27b AntibodyTitration: 0.5 ug/mlPositive Control: human testis, mouse liver, brain and testis)
WB (Western Blot)
(WB Suggested Anti-Rab27b AntibodyTitration: 0.5 ug/mlPositive Control: human testis, mouse liver, brain and testis)
WB (Western Blot)
(Rab27b antibody - C-terminal region validated by WB using Mouse Heart lysate at 1ug/ml.)
WB (Western Blot)
(Rab27b antibody - C-terminal region validated by WB using Mouse Heart lysate at 1ug/ml.)
Related Product Information for anti-RAB27B antibody
This is a rabbit polyclonal antibody against Rab27b. It was validated on Western Blot
Target Description: Rab27b may be involved in targeting uroplakins to urothelial apical membranes.
Target Description: Rab27b may be involved in targeting uroplakins to urothelial apical membranes.
Product Categories/Family for anti-RAB27B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
ras-related protein Rab-27B isoform 1
NCBI Official Synonym Full Names
RAB27B, member RAS oncogene family
NCBI Official Symbol
Rab27b
NCBI Official Synonym Symbols
2310021G14Rik; B130064M09Rik
NCBI Protein Information
ras-related protein Rab-27B
UniProt Protein Name
Ras-related protein Rab-27B
UniProt Gene Name
Rab27b
UniProt Entry Name
RB27B_MOUSE
Similar Products
Product Notes
The RAB27B rab27b (Catalog #AAA200624) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Rab27b antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Rab27b can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RAB27B rab27b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YCENPDIVLI GNKADLPDQR EVNERQAREL AEKYGIPYFE TSAATGQNVE. It is sometimes possible for the material contained within the vial of "Rab27b, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.