Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDI
Sequence Length
167
Applicable Applications for anti-RAB6A antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RAB6A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-RAB6A antibody
This gene encodes a member of the RAB family, which belongs to the small GTPase superfamily. GTPases of the RAB family bind to various effectors to regulate the targeting and fusion of transport carriers to acceptor compartments. This protein is located at the Golgi apparatus, which regulates trafficking in both a retrograde (from early endosomes and Golgi to the endoplasmic reticulum) and an anterograde (from the Golgi to the plasma membrane) directions. Myosin II is an effector of this protein in these processes. This protein is also involved in assembly of human cytomegalovirus (HCMV) by interacting with the cellular protein Bicaudal D1, which interacts with the HCMV virion tegument protein, pp150. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-RAB6A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24 kDa
NCBI Official Full Name
ras-related protein Rab-6A isoform d
NCBI Official Synonym Full Names
RAB6A, member RAS oncogene family
NCBI Official Symbol
RAB6A
NCBI Official Synonym Symbols
RAB6
NCBI Protein Information
ras-related protein Rab-6A
UniProt Protein Name
Ras-related protein Rab-6A
UniProt Gene Name
RAB6A
UniProt Synonym Gene Names
RAB6; Rab-6
UniProt Entry Name
RAB6A_HUMAN
Similar Products
Product Notes
The RAB6A rab6a (Catalog #AAA201546) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB6A Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB6A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RAB6A rab6a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ERKAKELNVM FIETSAKAGY NVKQLFRRVA AALPGMESTQ DRSREDMIDI. It is sometimes possible for the material contained within the vial of "RAB6A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
