Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199660_WB13.jpg WB (Western Blot) (WB Suggested Anti-RAB9A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit RAB9A Polyclonal Antibody | anti-RAB9A antibody

RAB9A antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
RAB9A; RAB9
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAB9A, Antibody; RAB9A antibody - middle region; anti-RAB9A antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKPKPSSSC
Sequence Length
201
Applicable Applications for anti-RAB9A antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RAB9A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RAB9A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

product-image-AAA199660_WB13.jpg WB (Western Blot) (WB Suggested Anti-RAB9A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(RAB9A antibody - middle region validated by WB using 1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)3. Human Cervical Cancer Cell transfected with mouse Rab9A-GFP (15ug) at 1:1000.)

product-image-AAA199660_WB15.jpg WB (Western Blot) (RAB9A antibody - middle region validated by WB using 1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)3. Human Cervical Cancer Cell transfected with mouse Rab9A-GFP (15ug) at 1:1000.)
Related Product Information for anti-RAB9A antibody
This is a rabbit polyclonal antibody against RAB9A. It was validated on Western Blot

Target Description: RAB9A is involved in the transport of proteins between the endosomes and the trans Golgi network.
Product Categories/Family for anti-RAB9A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
ras-related protein Rab-9A
NCBI Official Synonym Full Names
RAB9A, member RAS oncogene family
NCBI Official Symbol
RAB9A
NCBI Official Synonym Symbols
RAB9
NCBI Protein Information
ras-related protein Rab-9A
UniProt Protein Name
Ras-related protein Rab-9A
UniProt Gene Name
RAB9A
UniProt Synonym Gene Names
RAB9
UniProt Entry Name
RAB9A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RAB9A rab9a (Catalog #AAA199660) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB9A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RAB9A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RAB9A rab9a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FETSAKDATN VAAAFEEAVR RVLATEDRSD HLIQTDTVNL HRKPKPSSSC. It is sometimes possible for the material contained within the vial of "RAB9A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.