Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199911_WB13.jpg WB (Western Blot) (WB Suggested Anti-RABL4 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateIFT27 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit RABL4 Polyclonal Antibody | anti-IFT27 antibody

RABL4 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
IFT27; RAYL; BBS19; RABL4
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
RABL4, Antibody; RABL4 antibody - C-terminal region; anti-IFT27 antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA
Sequence Length
185
Applicable Applications for anti-IFT27 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 93%; Human: 100%; Mouse: 79%; Pig: 85%; Rat: 79%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RABL4
Protein Size (# AA)
185 amino acids
Protein Interactions
HSPB11; GOLGA2; PRDX5;
Blocking Peptide
For anti-IFT27 (MBS3208968) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RABL4 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateIFT27 is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA199911_WB13.jpg WB (Western Blot) (WB Suggested Anti-RABL4 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateIFT27 is supported by BioGPS gene expression data to be expressed in 721_B)

IHC (Immunohistochemistry)

(Rabbit Anti-RABL4 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes surrounding the portal vein only, signal is strong but tissue abundance is lowPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA199911_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-RABL4 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes surrounding the portal vein only, signal is strong but tissue abundance is lowPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-IFT27 antibody
This is a rabbit polyclonal antibody against RABL4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RABL4 belongs to the small GTPase superfamily, Ras family. RABL4 possesses GTPase activity By similarity.This gene encodes a putative GTP-binding protein similar to RAY/RAB1C. The protein is ras-related, but the function is unknown.
Product Categories/Family for anti-IFT27 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
intraflagellar transport protein 27 homolog isoform 2
NCBI Official Synonym Full Names
intraflagellar transport 27
NCBI Official Symbol
IFT27
NCBI Official Synonym Symbols
RAYL; BBS19; RABL4
NCBI Protein Information
intraflagellar transport protein 27 homolog
UniProt Protein Name
Intraflagellar transport protein 27 homolog
UniProt Gene Name
IFT27
UniProt Synonym Gene Names
RABL4; RAYL
UniProt Entry Name
IFT27_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IFT27 ift27 (Catalog #AAA199911) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RABL4 antibody - C-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's RABL4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the IFT27 ift27 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RAWALGQGLE CFETSVKEME NFEAPFHCLA KQFHQLYREK VEVFRALA. It is sometimes possible for the material contained within the vial of "RABL4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.