Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA268818_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using RAD54B antibody(AAA268818) at 1: 1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H + L) at 1: 10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)

Rabbit anti-Human, Mouse RAD54B Polyclonal Antibody | anti-RAD54B antibody

RAD54B Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
RAD54B; RDH54
Reactivity
Human, Mouse
Applications
Immunoprecipitation, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
RAD54B, Antibody; RAD54B Polyclonal Antibody; RAD54B; RDH54; anti-RAD54B antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
RQISKQGLCGAVVDLTKTSEHIQFSVEELKNLFTLHESSDCVTHDLLDCECTGEEVHTGDSLEKFIVSRDCQLGPHHQKSNSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT
Sequence Length
726
Applicable Applications for anti-RAD54B antibody
IP (Immunoprecipitation), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 781-910 of human RAD54B (NP_036547.1).
Positive sample
HeLa, Jurkat, DU145, HT-29, mouse testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using RAD54B antibody(AAA268818) at 1: 1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H + L) at 1: 10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)

product-image-AAA268818_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using RAD54B antibody(AAA268818) at 1: 1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H + L) at 1: 10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)
Related Product Information for anti-RAD54B antibody
The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Theoretical molecular weight: 103kDa
Actual molecular weight: 103kDa
NCBI Official Full Name
DNA repair and recombination protein RAD54B isoform 3
NCBI Official Synonym Full Names
RAD54 homolog B
NCBI Official Symbol
RAD54B
NCBI Official Synonym Symbols
RDH54
NCBI Protein Information
DNA repair and recombination protein RAD54B
UniProt Protein Name
DNA repair and recombination protein RAD54B
UniProt Gene Name
RAD54B
UniProt Entry Name
RA54B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RAD54B rad54b (Catalog #AAA268818) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAD54B Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RAD54B can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the RAD54B rad54b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RQISKQGLCG AVVDLTKTSE HIQFSVEELK NLFTLHESSD CVTHDLLDCE CTGEEVHTGD SLEKFIVSRD CQLGPHHQKS NSLKPLSMSQ LKQWKHFSGD HLNLTDPFLE RITENVSFIF QNITTQATGT. It is sometimes possible for the material contained within the vial of "RAD54B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.