Rabbit Rag1 Polyclonal Antibody | anti-RAG1 antibody
Rag1 antibody - C-terminal region
Gene Names
Rag1; Rag-1
Reactivity
Predicted Reactivity: Horse, Mouse, Pig, Rat (Tested Reactivity: Mouse)
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Rag1, Antibody; Rag1 antibody - C-terminal region; anti-RAG1 antibody
Host
Rabbit
Reactivity
Predicted Reactivity: Horse, Mouse, Pig, Rat (Tested Reactivity: Mouse)
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT
Sequence Length
1040
Applicable Applications for anti-RAG1 antibody
WB (Western Blot)
Homology
Horse: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Protein Size (# AA)
1040 amino acids
Protein Interactions
Gmeb1; Sf3a2; Kpna2; Rag1; UBE2C; UBE2H; UBE2E1; UBE2D2; UBE2D1; UBC; CDC34; Trav6-3; Rel; Nfkb1; Rela;
Replacement Item
This antibody may replace item sc-34269 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-RAG1 antibody
This is a rabbit polyclonal antibody against Rag1. It was validated on Western Blot
Target Description: As a catalytic component of the RAG complex, a multiprotein complex that mediates the DNA cleavage phase during V(D)J recombination. V(D)J recombination assembles a diverse repertoire of immunoglobulin and T-cell receptor genes in developing B and T lymphocytes through rearrangement of different V (variable), in some cases D (diversity), and J (joining) gene segments. In the RAG complex, RAG1 mediates the DNA-binding to the conserved recombination signal sequences (RSS) and catalyzes the DNA cleavage activities by introducing a double-strand break between the RSS and the adjacent coding segment. RAG2 is not a catalytic component but is required for all known catalytic activities.
Target Description: As a catalytic component of the RAG complex, a multiprotein complex that mediates the DNA cleavage phase during V(D)J recombination. V(D)J recombination assembles a diverse repertoire of immunoglobulin and T-cell receptor genes in developing B and T lymphocytes through rearrangement of different V (variable), in some cases D (diversity), and J (joining) gene segments. In the RAG complex, RAG1 mediates the DNA-binding to the conserved recombination signal sequences (RSS) and catalyzes the DNA cleavage activities by introducing a double-strand break between the RSS and the adjacent coding segment. RAG2 is not a catalytic component but is required for all known catalytic activities.
Product Categories/Family for anti-RAG1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
119kDa
NCBI Official Full Name
V(D)J recombination-activating protein 1
NCBI Official Synonym Full Names
recombination activating gene 1
NCBI Official Symbol
Rag1
NCBI Official Synonym Symbols
Rag-1
NCBI Protein Information
V(D)J recombination-activating protein 1
UniProt Protein Name
V(D)J recombination-activating protein 1
UniProt Gene Name
Rag1
UniProt Synonym Gene Names
RAG-1
UniProt Entry Name
RAG1_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The RAG1 rag1 (Catalog #AAA199201) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Rag1 antibody - C-terminal region reacts with Predicted Reactivity: Horse, Mouse, Pig, Rat (Tested Reactivity: Mouse) and may cross-react with other species as described in the data sheet. AAA Biotech's Rag1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RAG1 rag1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IIERDGSIGA WASEGNESGN KLFRRFRKMN ARQSKCYEME DVLKHHWLYT. It is sometimes possible for the material contained within the vial of "Rag1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
