Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA108336_WB8.jpg WB (Western Blot) (Tissue analyzed: Human Fetal Liver; Antibody Dilution: 1.0ug/ml)

Rabbit RBM47 Polyclonal Antibody | anti-RBM47 antibody

RBM47 antibody

Gene Names
RBM47; NET18
Reactivity
Human, Mouse, Rat, Dog
Applications
Western Blot
Purity
Affinity purified
Synonyms
RBM47, Antibody; RBM47 antibody; Polyclonal RBM47; Anti-RBM47; RNA Binding Motif Protein 47; FLJ21643; RBM 47; DKFZp686F02235; RBM47; RBM-47; FLJ21344; FLJ20273; anti-RBM47 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
RBM47 antibody was raised against the middle region of RBM47
Purity/Purification
Affinity purified
Form/Format
Purified antibody supplied as liquid in PBS buffer with 0.09% NaN3, AND 2% Sucrose.
Concentration
1 mg/ml (varies by lot)
Sequence
HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA
Sequence Length
497
Applicable Applications for anti-RBM47 antibody
WB (Western Blot)
Biological Significance
RBM47 may be involved in RNA binding and nucleotide binding.
Cross-Reactivity
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Immunogen
RBM47 antibody was raised using the middle region of RBM47
Preparation and Storage
Store at 4°C short term , -20°C long term. Avoid repeat freeze-thaws.

WB (Western Blot)

(Tissue analyzed: Human Fetal Liver; Antibody Dilution: 1.0ug/ml)

product-image-AAA108336_WB8.jpg WB (Western Blot) (Tissue analyzed: Human Fetal Liver; Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Tissue analyzed: Human Fetal Heart; Antibody Dilution: 1.0ug/ml)

product-image-AAA108336_WB10.jpg WB (Western Blot) (Tissue analyzed: Human Fetal Heart; Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Tissue analyzed: Human Fetal Muscle; Antibody Dilution: 1.0ug/ml)

product-image-AAA108336_WB11.jpg WB (Western Blot) (Tissue analyzed: Human Fetal Muscle; Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Tissue analyzed: Human Fetal Lung; Antibody Dilution: 1.0ug/ml)

product-image-AAA108336_WB13.jpg WB (Western Blot) (Tissue analyzed: Human Fetal Lung; Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Recommended RBM47 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: NCI-H226)

product-image-AAA108336_WB15.jpg WB (Western Blot) (Recommended RBM47 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: NCI-H226)
Related Product Information for anti-RBM47 antibody
Rabbit polyclonal RBM47 antibody raised against the middle region of RBM47
Product Categories/Family for anti-RBM47 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
57 kDa (MW of target protein)
NCBI Official Full Name
RBM47 protein, partial
NCBI Official Synonym Full Names
RNA binding motif protein 47
NCBI Official Symbol
RBM47
NCBI Official Synonym Symbols
NET18
NCBI Protein Information
RNA-binding protein 47
UniProt Protein Name
RNA-binding protein 47
UniProt Gene Name
RBM47
UniProt Entry Name
RBM47_HUMAN

Similar Products

Product Notes

The RBM47 rbm47 (Catalog #AAA108336) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBM47 antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's RBM47 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RBM47 rbm47 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HFTSREDAVH AMNNLNGTEL EGSCLEVTLA KPVDKEQYSR YQKAARGGGA. It is sometimes possible for the material contained within the vial of "RBM47, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.