Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201117_WB13.jpg WB (Western Blot) (WB Suggested Anti-RBMX AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole CellRBMX is supported by BioGPS gene expression data to be expressed in OVCAR3)

Rabbit RBMX Polyclonal Antibody | anti-RBMX antibody

RBMX antibody - C-terminal region

Gene Names
RBMX; RNMX; HNRPG; HNRNPG; MRXS11; RBMXP1; RBMXRT; hnRNP-G
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RBMX, Antibody; RBMX antibody - C-terminal region; anti-RBMX antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDS
Sequence Length
391
Applicable Applications for anti-RBMX antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RBMX AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole CellRBMX is supported by BioGPS gene expression data to be expressed in OVCAR3)

product-image-AAA201117_WB13.jpg WB (Western Blot) (WB Suggested Anti-RBMX AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole CellRBMX is supported by BioGPS gene expression data to be expressed in OVCAR3)

WB (Western Blot)

(Host: RabbitTarget Name: RBMXSample Type: HelaAntibody Dilution: 1.0ug/mlRBMX is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA201117_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: RBMXSample Type: HelaAntibody Dilution: 1.0ug/mlRBMX is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-RBMX antibody
This is a rabbit polyclonal antibody against RBMX. It was validated on Western Blot

Target Description: This gene belongs to the RBMY gene family which includes candidate Y chromosome spermatogenesis genes. This gene, an active X chromosome homolog of the Y chromosome RBMY gene, is widely expressed whereas the RBMY gene evolved a male-specific function in spermatogenesis. Pseudogenes of this gene, found on chromosomes 1, 4, 9, 11, and 6, were likely derived by retrotransposition from the original gene. Alternatively spliced transcript variants encoding different isoforms have been identified. A snoRNA gene (SNORD61) is found in one of its introns.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
RNA-binding motif protein, X chromosome isoform 1
NCBI Official Synonym Full Names
RNA binding motif protein X-linked
NCBI Official Symbol
RBMX
NCBI Official Synonym Symbols
RNMX; HNRPG; HNRNPG; MRXS11; RBMXP1; RBMXRT; hnRNP-G
NCBI Protein Information
RNA-binding motif protein, X chromosome
UniProt Protein Name
RNA-binding motif protein, X chromosome
UniProt Gene Name
RBMX
UniProt Synonym Gene Names
HNRPG; RBMXP1; hnRNP G
UniProt Entry Name
RBMX_HUMAN

Similar Products

Product Notes

The RBMX rbmx (Catalog #AAA201117) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBMX antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RBMX can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RBMX rbmx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSSRDGYGGS RDSYSSSRSD LYSSGRDRVG RQERGLPPSM ERGYPPPRDS. It is sometimes possible for the material contained within the vial of "RBMX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.