Rabbit RBPMS Polyclonal Antibody | anti-RBPMS antibody
RBPMS Antibody
Gene Names
RBPMS; HERMES
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
RBPMS, Antibody; RBPMS Antibody; Rabbit Polyclonal RBPMS Antibody raised against the N terminal of RBPMS; Polyclonal RBPMS antibody; Anti-RBPMS antibody; RNA Binding Protein With Multiple Splicing antibody; HERMES antibody; anti-RBPMS antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
RBPMS antibody was raised against the N terminal of RBPMS
Purity/Purification
Total IgG Protein A purified
Form/Format
Liquid; in 1x PBS buffer with 0.09% (w/v) Sodium Azide and 2% Sucrose.
Concentration
1 mg/ml (varies by lot)
Sequence Length
204
Applicable Applications for anti-RBPMS antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
RBPMS antibody was raised using the N terminal of RBPMS corresponding to a region with amino acids LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ
Cross-Reactivity
Human, Mouse, Rat, Dog
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-RBPMS antibody
RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus.
Product Categories/Family for anti-RBPMS antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24 kDa (MW of target protein)
NCBI Official Full Name
RNA-binding protein with multiple splicing isoform B
NCBI Official Synonym Full Names
RNA binding protein, mRNA processing factor
NCBI Official Symbol
RBPMS
NCBI Official Synonym Symbols
HERMES
NCBI Protein Information
RNA-binding protein with multiple splicing
UniProt Protein Name
RNA-binding protein with multiple splicing
UniProt Gene Name
RBPMS
UniProt Synonym Gene Names
HERMES; RBP-MS; Hermes
UniProt Entry Name
RBPMS_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The RBPMS rbpms (Catalog #AAA225804) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RBPMS can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the RBPMS rbpms for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBPMS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
