Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199489_WB13.jpg WB (Western Blot) (WB Suggested Anti-FAM134B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

Rabbit RETREG1 Polyclonal Antibody | anti-RETREG1 antibody

RETREG1 Antibody - middle region

Gene Names
RETREG1; JK1; JK-1; FAM134B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RETREG1, Antibody; RETREG1 Antibody - middle region; anti-RETREG1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DFGIGEYINQKKRERSEADKEKSHKDDSELDFSALCPKISLTVAAKELSV
Sequence Length
497
Applicable Applications for anti-RETREG1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FAM134B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FAM134B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

product-image-AAA199489_WB13.jpg WB (Western Blot) (WB Suggested Anti-FAM134B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

WB (Western Blot)

(Host: RabbitTarget Name: FAM134BSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA199489_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: FAM134BSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RETREG1 antibody
This is a rabbit polyclonal antibody against FAM134B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a cis-Golgi transmembrane protein that may be necessary for the long-term survival of nociceptive and autonomic ganglion neurons. Mutations in this gene are a cause of hereditary sensory and autonomic neuropathy type IIB (HSAN IIB), and this gene may also play a role in susceptibility to vascular dementia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for anti-RETREG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
reticulophagy regulator 1 isoform 1
NCBI Official Synonym Full Names
reticulophagy regulator 1
NCBI Official Symbol
RETREG1
NCBI Official Synonym Symbols
JK1; JK-1; FAM134B
NCBI Protein Information
reticulophagy regulator 1
UniProt Protein Name
Protein FAM134B
UniProt Gene Name
FAM134B
UniProt Entry Name
F134B_HUMAN

Similar Products

Product Notes

The RETREG1 fam134b (Catalog #AAA199489) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RETREG1 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's RETREG1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RETREG1 fam134b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DFGIGEYINQ KKRERSEADK EKSHKDDSEL DFSALCPKIS LTVAAKELSV. It is sometimes possible for the material contained within the vial of "RETREG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.