WB (Western Blot)
(WB Suggested Anti-Rgs10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Mouse Thymus)
Rabbit Rgs10 Polyclonal Antibody | anti-RGS10 antibody
Rgs10 antibody - N-terminal region
Gene Names
Rgs10; 2310010N19Rik
Reactivity
Cow, Human, Mouse, Pig, Rat
Applications
Western Blot, Flow Cytometry, Functional Assay
Purity
Affinity Purified
Synonyms
Rgs10, Antibody; Rgs10 antibody - N-terminal region; anti-RGS10 antibody
Host
Rabbit
Reactivity
Cow, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDPE
Sequence Length
181
Applicable Applications for anti-RGS10 antibody
WB (Western Blot), FCM/FACS (Flow Cytometry)
Homology
Cow: 93%; Human: 93%; Mouse: 100%; Pig: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-Rgs10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Mouse Thymus)
WB (Western Blot)
(WB Suggested Anti-Rgs10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Mouse Thymus)
FCM/FACS (Flow Cytometry)
(FACS -- Sample type: Bone marrow derived monocytes from mice BV2 cellsDilution: 1ug/mL)
FCM/FACS (Flow Cytometry)
(FACS -- Sample type: Bone marrow derived monocytes from mice BV2 cellsDilution: 1ug/mL)
Related Product Information for anti-RGS10 antibody
This is a rabbit polyclonal antibody against Rgs10. It was validated on Western Blot
Target Description: Rgs10 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Rgs10 associates specifically with the activated forms of the G protein subunits G(i)-alpha and G(z)-alpha but fails to interact with the structurally and functionally distinct G(s)-alpha subunit. Activity of Rgs10 on G(z)-alpha is inhibited by palmitoylation of the G-protein.
Target Description: Rgs10 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Rgs10 associates specifically with the activated forms of the G protein subunits G(i)-alpha and G(z)-alpha but fails to interact with the structurally and functionally distinct G(s)-alpha subunit. Activity of Rgs10 on G(z)-alpha is inhibited by palmitoylation of the G-protein.
Product Categories/Family for anti-RGS10 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
regulator of G-protein signaling 10
NCBI Official Synonym Full Names
regulator of G-protein signalling 10
NCBI Official Symbol
Rgs10
NCBI Official Synonym Symbols
2310010N19Rik
NCBI Protein Information
regulator of G-protein signaling 10
UniProt Protein Name
Regulator of G-protein signaling 10
UniProt Gene Name
Rgs10
UniProt Synonym Gene Names
RGS10
UniProt Entry Name
RGS10_MOUSE
Similar Products
Product Notes
The RGS10 rgs10 (Catalog #AAA199187) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Rgs10 antibody - N-terminal region reacts with Cow, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Rgs10 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), FCM/FACS (Flow Cytometry). Researchers should empirically determine the suitability of the RGS10 rgs10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MFTRAVSRLS RKRPPSDIHD GDGSSSSGHQ SLKSTAKWAS SLENLLEDPE. It is sometimes possible for the material contained within the vial of "Rgs10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.