Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201697_WB13.jpg WB (Western Blot) (WB Suggested Anti-RGS5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

Rabbit RGS5 Polyclonal Antibody | anti-RGS5 antibody

RGS5 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
RGS5; MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RGS5, Antibody; RGS5 antibody - middle region; anti-RGS5 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKS
Sequence Length
181
Applicable Applications for anti-RGS5 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 84%; Pig: 76%; Rat: 84%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RGS5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RGS5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

product-image-AAA201697_WB13.jpg WB (Western Blot) (WB Suggested Anti-RGS5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

WB (Western Blot)

(Hum. Fetal Heart)

product-image-AAA201697_WB15.jpg WB (Western Blot) (Hum. Fetal Heart)
Related Product Information for anti-RGS5 antibody
This is a rabbit polyclonal antibody against RGS5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-663 AU130764.1 1-663 664-2587 BX537427.1 499-2422 2588-3235 BU187973.1 34-681 3236-3746 AL600981.1 90-600 3747-4143 AA486366.1 76-472 4144-4358 AA974387.1 113-327 c 4359-4664 BX537427.1 4194-4499 4665-5573 AF176919.1 724-1632 5574-5848 BX537427.1 5409-5683
Product Categories/Family for anti-RGS5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
regulator of G-protein signaling 5 isoform 1
NCBI Official Synonym Full Names
regulator of G protein signaling 5
NCBI Official Symbol
RGS5
NCBI Official Synonym Symbols
MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129
NCBI Protein Information
regulator of G-protein signaling 5
UniProt Protein Name
Regulator of G-protein signaling 5
UniProt Gene Name
RGS5
UniProt Synonym Gene Names
RGS5
UniProt Entry Name
RGS5_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RGS5 rgs5 (Catalog #AAA201697) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RGS5 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RGS5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RGS5 rgs5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PDSVGDLVIP YNEKPEKPAK TQKTSLDEAL QWRDSLDKLL QNNYGLASFK S. It is sometimes possible for the material contained within the vial of "RGS5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.