Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197709_WB13.jpg WB (Western Blot) (WB Suggested Anti-RGS6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysate)

Rabbit RGS6 Polyclonal Antibody | anti-RGS6 antibody

RGS6 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
RGS6; GAP; S914; HA117
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RGS6, Antibody; RGS6 antibody - N-terminal region; anti-RGS6 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AQGSGDQRAVGVADPEESSPNMIVYCKIEDIITKMQDDKTGGVPIRTVKS
Sequence Length
472
Applicable Applications for anti-RGS6 antibody
WB (Western Blot)
Homology
Human: 100%; Mouse: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RGS6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RGS6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysate)

product-image-AAA197709_WB13.jpg WB (Western Blot) (WB Suggested Anti-RGS6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: RGS6Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlRGS6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA197709_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: RGS6Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlRGS6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-RGS6 antibody
This is a rabbit polyclonal antibody against RGS6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Members of the RGS (regulator of G protein signaling) family, such as RGS6, modulate G protein function by activating the intrinsic GTPase activity of the alpha (guanine nucleotide-binding) subunits.Members of the RGS (regulator of G protein signaling) family have been shown to modulate the functioning of G proteins by activating the intrinsic GTPase activity of the alpha (guanine nucleotide-binding) subunits.[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
regulator of G-protein signaling 6 isoform 2
NCBI Official Synonym Full Names
regulator of G protein signaling 6
NCBI Official Symbol
RGS6
NCBI Official Synonym Symbols
GAP; S914; HA117
NCBI Protein Information
regulator of G-protein signaling 6
UniProt Protein Name
Regulator of G-protein signaling 6
UniProt Gene Name
RGS6
UniProt Synonym Gene Names
RGS6
UniProt Entry Name
RGS6_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RGS6 rgs6 (Catalog #AAA197709) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RGS6 antibody - N-terminal region reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RGS6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RGS6 rgs6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AQGSGDQRAV GVADPEESSP NMIVYCKIED IITKMQDDKT GGVPIRTVKS. It is sometimes possible for the material contained within the vial of "RGS6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.