Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281586_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using RhoA antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit anti-Human RhoA Polyclonal Antibody | anti-RhoA antibody

[KO Validated] RhoA Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
RHOA; ARHA; ARH12; RHO12; RHOH12
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
RhoA, Antibody; [KO Validated] RhoA Rabbit pAb; ARH12; ARHA; RHO12; RHOH12; Rho; RHOA; RhoA; anti-RhoA antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Applicable Applications for anti-RhoA antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human RhoA (NP_001655.1).
Cellular Location
Cell membrane, Cell projection, Cleavage furrow, Cytoplasm, Cytoplasmic side, Lipid-anchor, Midbody, cell cortex, cytoskeleton, lamellipodium
Positive Samples
HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using RhoA antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281586_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using RhoA antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using [KO Validated] RhoA Rabbit pAb at dilution of 1:350 (40x lens).)

product-image-AAA281586_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using [KO Validated] RhoA Rabbit pAb at dilution of 1:350 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts from normal (control) and RhoA knockout (KO) HeLa cells, using RhoA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

product-image-AAA281586_WB15.jpg WB (Western Blot) (Western blot analysis of extracts from normal (control) and RhoA knockout (KO) HeLa cells, using RhoA antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
Related Product Information for anti-RhoA antibody
Background: This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
387
UniProt Accession #
Molecular Weight
193
NCBI Official Full Name
Transforming protein RhoA
NCBI Official Synonym Full Names
ras homolog family member A
NCBI Official Symbol
RHOA
NCBI Official Synonym Symbols
ARHA; ARH12; RHO12; RHOH12
NCBI Protein Information
transforming protein RhoA; h12; oncogene RHO H12; rho cDNA clone 12; Aplysia ras-related homolog 12; small GTP binding protein RhoA; ras homolog gene family, member A
UniProt Protein Name
Transforming protein RhoA
UniProt Gene Name
RHOA
UniProt Synonym Gene Names
ARH12; ARHA; RHO12; h12
UniProt Entry Name
RHOA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RhoA rhoa (Catalog #AAA281586) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] RhoA Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RhoA can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the RhoA rhoa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAIRKKLVI VGDGACGKTC LLIVFSKDQF PEVYVPTVFE NYVADIEVDG KQVELALWDT AGQEDYDRLR PLSYPDTDVI LMCFSIDSPD SLENIPEKWT PEVKHFCPNV PIILVGNKKD LRNDEHTRRE LAKMKQEPVK PEEGRDMANR IGAFGYMECS AKTKDGVREV FEMATRAALQ ARRGKKKSGC LVL. It is sometimes possible for the material contained within the vial of "RhoA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.