Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199114_WB11.jpg WB (Western Blot) (WB Suggested Anti-RHOD Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

Rabbit RHOD Polyclonal Antibody | anti-RHOD antibody

RHOD antibody - N-terminal region

Gene Names
RHOD; Rho; ARHD; RHOM; RHOHP1
Reactivity
Guinea Pig, Human, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
RHOD, Antibody; RHOD antibody - N-terminal region; anti-RHOD antibody
Ordering
Host
Rabbit
Reactivity
Guinea Pig, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVF
Sequence Length
210
Applicable Applications for anti-RHOD antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Guinea Pig: 79%; Human: 100%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RHOD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RHOD Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

product-image-AAA199114_WB11.jpg WB (Western Blot) (WB Suggested Anti-RHOD Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

IHC (Immunohiostchemistry)

(RHOD antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199114_IHC13.jpg IHC (Immunohiostchemistry) (RHOD antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(RHOD antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: Cytoplasm and membrane of bronchial epithelial tissuePrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199114_IHC15.jpg IHC (Immunohistochemistry) (RHOD antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: Cytoplasm and membrane of bronchial epithelial tissuePrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-RHOD antibody
This is a rabbit polyclonal antibody against RHOD. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. RHOD binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. The protein encoded by this gene binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-RHOD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
rho-related GTP-binding protein RhoD isoform 1
NCBI Official Synonym Full Names
ras homolog family member D
NCBI Official Symbol
RHOD
NCBI Official Synonym Symbols
Rho; ARHD; RHOM; RHOHP1
NCBI Protein Information
rho-related GTP-binding protein RhoD
UniProt Protein Name
Rho-related GTP-binding protein RhoD
UniProt Gene Name
RHOD
UniProt Synonym Gene Names
ARHD; RhoHP1
UniProt Entry Name
RHOD_HUMAN

Similar Products

Product Notes

The RHOD rhod (Catalog #AAA199114) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RHOD antibody - N-terminal region reacts with Guinea Pig, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RHOD can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the RHOD rhod for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAAQAAGEEA PPGVRSVKVV LVGDGGCGKT SLLMVFADGA FPESYTPTVF. It is sometimes possible for the material contained within the vial of "RHOD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.