Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24070_WB6.jpg WB (Western Blot) (PEPP-2 polyclonal antibody. Western Blot analysis of PEPP-2 expression in K-562.)

Mouse RHOXF2 Polyclonal Antibody

RHOXF2 (Rhox Homeobox Family Member 2, Paired-like Homeobox Protein PEPP-2, Testis Homeobox Gene 1, PEPP2, THG1, CT107)

Average rating 0.0
No ratings yet
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RHOXF2, Antibody; RHOXF2 (Rhox Homeobox Family Member 2, Paired-like Homeobox Protein PEPP-2, Testis Homeobox Gene 1, PEPP2, THG1, CT107); Anti -RHOXF2 (Rhox Homeobox Family Member 2, Paired-like Homeobox Protein PEPP-2, Testis Homeobox Gene 1, PEPP2, THG1, CT107); anti-RHOXF2 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RHOXF2. Species Crossreactivity: mouse and rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQYSRPRGAVGGLEPGNAQQPNVHAFTPLQLQELERIFQREQFPSEFLRRRLARSMNVTELAVQIWFENRRAKWRRHQRALMARNMLPFMAVGQPVMVTAAEAITAPLFISGMRDDYFWDHSHSSSLCFPMPPFPPPSLPLPLMLLPPMPPAGQAEFGPFPFVIVPSFTFPNV
Applicable Applications for anti-RHOXF2 antibody
WB (Western Blot), IF (Immunofluorescence)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human RHOXF2, aa1-289 (AAH21719).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(PEPP-2 polyclonal antibody. Western Blot analysis of PEPP-2 expression in K-562.)

product-image-AAA24070_WB6.jpg WB (Western Blot) (PEPP-2 polyclonal antibody. Western Blot analysis of PEPP-2 expression in K-562.)

IF (Immunofluorescence)

(Immunofluorescence of purified antibody to PEPP-2 on HeLa cell. [antibody concentration 10ug/ml].)

product-image-AAA24070_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of purified antibody to PEPP-2 on HeLa cell. [antibody concentration 10ug/ml].)

WB (Western Blot)

(Western Blot analysis of RHOXF2 expression in transfected 293T cell line by RHOXF2 polyclonal antibody. Lane 1: PEPP-2 transfected lysate (31.79kD). Lane 2: Non-transfected lysate.)

product-image-AAA24070_WB4.jpg WB (Western Blot) (Western Blot analysis of RHOXF2 expression in transfected 293T cell line by RHOXF2 polyclonal antibody. Lane 1: PEPP-2 transfected lysate (31.79kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(RHOXF2 polyclonal antibody. Western Blot analysis of RHOXF2 expression in NIH/3T3.)

product-image-AAA24070_WB3.jpg WB (Western Blot) (RHOXF2 polyclonal antibody. Western Blot analysis of RHOXF2 expression in NIH/3T3.)

WB (Western Blot)

(RHOXF2 polyclonal antibody. Western Blot analysis of RHOXF2 expression in Raw 264.7.)

product-image-AAA24070_WB2.jpg WB (Western Blot) (RHOXF2 polyclonal antibody. Western Blot analysis of RHOXF2 expression in Raw 264.7.)

WB (Western Blot)

(RHOXF2 polyclonal antibody. Western Blot analysis of RHOXF2 expression in PC-12.)

product-image-AAA24070_WB.jpg WB (Western Blot) (RHOXF2 polyclonal antibody. Western Blot analysis of RHOXF2 expression in PC-12.)
Related Product Information for anti-RHOXF2 antibody
RHOXF2 (Rhox homeobox family member 2) belongs to the paired like homeobox family.
Product Categories/Family for anti-RHOXF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
RHOXF2 protein

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RHOXF2 (Catalog #AAA24070) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RHOXF2 (Rhox Homeobox Family Member 2, Paired-like Homeobox Protein PEPP-2, Testis Homeobox Gene 1, PEPP2, THG1, CT107) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RHOXF2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the RHOXF2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEPPDQCSQY MTSLLSPAVD DEKELQDMNA MVLSLTEEVK EEEEDAQPEP EQGTAAGEKL KSAGAQGGEE KDGGGEEKDG GGAGVPGHLW EGDLEGTSGS DGNVEDSDQS EKEPGQQYSR PRGAVGGLEP GNAQQPNVHA FTPLQLQELE RIFQREQFPS EFLRRRLARS MNVTELAVQI WFENRRAKWR RHQRALMARN MLPFMAVGQP VMVTAAEAIT APLFISGMRD DYFWDHSHSS SLCFPMPPFP PPSLPLPLML LPPMPPAGQA EFGPFPFVIV PSFTFPNV. It is sometimes possible for the material contained within the vial of "RHOXF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.