Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201394_WB11.jpg WB (Western Blot) (WB Suggested Anti-RINL AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit anti-Human RINL Polyclonal Antibody | anti-RINL antibody

RINL Antibody - N-terminal region

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Purity
Affinity Purified
Synonyms
RINL, Antibody; RINL Antibody - N-terminal region; anti-RINL antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ETHRGWGREQTPQETEPEAAQRHDPAPRNPAPHGVSWVKGPLSPEVDHPG
Sequence Length
452
Applicable Applications for anti-RINL antibody
WB (Western Blot), IP (Immunoprecipitation)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RINL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RINL AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

product-image-AAA201394_WB11.jpg WB (Western Blot) (WB Suggested Anti-RINL AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

WB (Western Blot)

(Lanes:Lane 1: Jurkat lysateLane 2: HeLa lysateLane 3: GFP-Rinl transfected COS7 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name:RINLSubmitted by:Barbara Woller; Medical University of Vienna)

product-image-AAA201394_WB13.jpg WB (Western Blot) (Lanes:Lane 1: Jurkat lysateLane 2: HeLa lysateLane 3: GFP-Rinl transfected COS7 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name:RINLSubmitted by:Barbara Woller; Medical University of Vienna)

IP (Immunoprecipitation)

(Sample Type: r-RINLAmount and Sample Type :GFP-hRinl transfected COS7 cell lysateAmount of IP Antibody :10ugPrimary Antibody :anti-GFPPrimary Antibody Dilution :1:1000Secondary Antibody :Goat anti-rabbit-HRPSecondary Antibody Dilution :1:5000Gene Name :RINLSubmitted by :Barbara Woller; Medical University of Vienna)

product-image-AAA201394_IP15.jpg IP (Immunoprecipitation) (Sample Type: r-RINLAmount and Sample Type :GFP-hRinl transfected COS7 cell lysateAmount of IP Antibody :10ugPrimary Antibody :anti-GFPPrimary Antibody Dilution :1:1000Secondary Antibody :Goat anti-rabbit-HRPSecondary Antibody Dilution :1:5000Gene Name :RINLSubmitted by :Barbara Woller; Medical University of Vienna)
Related Product Information for anti-RINL antibody
This is a rabbit polyclonal antibody against RINL. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-RINL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
ras and Rab interactor-like protein isoform 2
NCBI Official Synonym Full Names
Ras and Rab interactor like
NCBI Official Symbol
RINL
NCBI Protein Information
ras and Rab interactor-like protein
UniProt Protein Name
Ras and Rab interactor-like protein
UniProt Gene Name
RINL
UniProt Entry Name
RINL_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RINL rinl (Catalog #AAA201394) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RINL Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RINL can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IP (Immunoprecipitation). Researchers should empirically determine the suitability of the RINL rinl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETHRGWGREQ TPQETEPEAA QRHDPAPRNP APHGVSWVKG PLSPEVDHPG. It is sometimes possible for the material contained within the vial of "RINL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.