Rabbit anti-Mouse, Rat RND1 Polyclonal Antibody | anti-RND1 antibody
RND1 Polyclonal Antibody
Gene Names
RND1; ARHS; RHO6; RHOS
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
RND1, Antibody; RND1 Polyclonal Antibody; RND1; ARHS; RHO6; RHOS; Rho family GTPase 1; anti-RND1 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
ALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM
Sequence Length
232
Applicable Applications for anti-RND1 antibody
WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 103-232 of human RND1 (NP_055285.1).
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Cytoplasm, Cytoplasmic side, Lipid-anchor, cytoskeleton
Positive Samples
Mouse brain, Mouse liver, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-RND1 antibody
This gene encodes a protein that belongs to the Rho GTPase family. Members of this family regulate the organization of the actin cytoskeleton in response to extracellular growth factors. A similar protein in rat interacts with a microtubule regulator to control axon extension.
Product Categories/Family for anti-RND1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 26kDa
Observed: 26kDa
Observed: 26kDa
NCBI Official Full Name
rho-related GTP-binding protein Rho6
NCBI Official Synonym Full Names
Rho family GTPase 1
NCBI Official Symbol
RND1
NCBI Official Synonym Symbols
ARHS; RHO6; RHOS
NCBI Protein Information
rho-related GTP-binding protein Rho6
UniProt Protein Name
Rho-related GTP-binding protein Rho6
UniProt Gene Name
RND1
UniProt Synonym Gene Names
RHO6
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The RND1 rnd1 (Catalog #AAA281150) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RND1 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RND1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RND1 rnd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ALKKWRTEIL DYCPSTRVLL IGCKTDLRTD LSTLMELSHQ KQAPISYEQG CAIAKQLGAE IYLEGSAFTS EKSIHSIFRT ASMLCLNKPS PLPQKSPVRS LSKRLLHLPS RSELISSTFK KEKAKSCSIM. It is sometimes possible for the material contained within the vial of "RND1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
