Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199546_WB11.jpg WB (Western Blot) (WB Suggested Anti-ROBO2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

Rabbit ROBO2 Polyclonal Antibody | anti-ROBO2 antibody

ROBO2 Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
ROBO2; SAX3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ROBO2, Antibody; ROBO2 Antibody - N-terminal region; anti-ROBO2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGK
Sequence Length
1378
Applicable Applications for anti-ROBO2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ROBO2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ROBO2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

product-image-AAA199546_WB11.jpg WB (Western Blot) (WB Suggested Anti-ROBO2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

WB (Western Blot)

(Host: RabbitTarget Name: ROBO2Sample Tissue: Human RPMI 8226 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199546_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: ROBO2Sample Tissue: Human RPMI 8226 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ROBO2Sample Tissue: Human NCI-H226 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199546_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: ROBO2Sample Tissue: Human NCI-H226 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-ROBO2 antibody
This is a rabbit polyclonal antibody against ROBO2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene belongs to the ROBO family, part of the immunoglobulin superfamily of proteins that are highly conserved from fly to human. The encoded protein is a transmembrane receptor for the slit homolog 2 protein and functions in axon guidance and cell migration. Mutations in this gene are associated with vesicoureteral reflux, characterized by the backward flow of urine from the bladder into the ureters or the kidney. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
151kDa
NCBI Official Full Name
roundabout homolog 2 isoform ROBO2b
NCBI Official Synonym Full Names
roundabout guidance receptor 2
NCBI Official Symbol
ROBO2
NCBI Official Synonym Symbols
SAX3
NCBI Protein Information
roundabout homolog 2
UniProt Protein Name
Roundabout homolog 2
UniProt Gene Name
ROBO2
UniProt Synonym Gene Names
KIAA1568
UniProt Entry Name
ROBO2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ROBO2 robo2 (Catalog #AAA199546) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ROBO2 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ROBO2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ROBO2 robo2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PQPTVRWKKD DADLPRGRYD IKDDYTLRIK KTMSTDEGTY MCIAENRVGK. It is sometimes possible for the material contained within the vial of "ROBO2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.