Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28622_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of paraffin-embedded Mouse kidney using ROMO1 Rabbit pAb(AAA28622) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit anti-Human ROMO1 Polyclonal Antibody | anti-ROMO1 antibody

ROMO1 Rabbit pAb

Reactivity
Human
Applications
Western Blot, Immunofluorescence, Immunocytochemistry, ELISA
Purity
Affinity purification
Synonyms
ROMO1, Antibody; ROMO1 Rabbit pAb; MTGM; MTGMP; C20orf52; bA353C18.2; ROMO1; anti-ROMO1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC
Applicable Applications for anti-ROMO1 antibody
WB (Western Blot), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA
Application Notes
WB: 1:500-1:1000
IF/ICC: 1:50-1:200
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-79 of human ROMO1(NP_542786.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of paraffin-embedded Mouse kidney using ROMO1 Rabbit pAb(AAA28622) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28622_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of paraffin-embedded Mouse kidney using ROMO1 Rabbit pAb(AAA28622) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of lysates from Rat heart using ROMO1 Rabbit pAb (AAA28622) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

product-image-AAA28622_WB5.jpg WB (Western Blot) (Western blot analysis of lysates from Rat heart using ROMO1 Rabbit pAb (AAA28622) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

WB (Western Blot)

(Western blot analysis of lysates from Rat heart cells using ROMO1 Rabbit pAb (AAA28622) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

product-image-AAA28622_WB4.jpg WB (Western Blot) (Western blot analysis of lysates from Rat heart cells using ROMO1 Rabbit pAb (AAA28622) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

WB (Western Blot)

(Western blot analysis of various lysates using ROMO1 Rabbit pAb (AAA28622) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 ug per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s.)

product-image-AAA28622_WB3.jpg WB (Western Blot) (Western blot analysis of various lysates using ROMO1 Rabbit pAb (AAA28622) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 ug per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s.)

WB (Western Blot)

(Western blot analysis of various lysates using ROMO1 Rabbit pAb (AAA28622) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 ug per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s.)

product-image-AAA28622_WB2.jpg WB (Western Blot) (Western blot analysis of various lysates using ROMO1 Rabbit pAb (AAA28622) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 ug per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse kidney using ROMO1 Rabbit pAb (AAA28622) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA28622_WB.jpg WB (Western Blot) (Western blot analysis of lysates from Mouse kidney using ROMO1 Rabbit pAb (AAA28622) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-ROMO1 antibody
The protein encoded by this gene is a mitochondrial membrane protein that is responsible for increasing the level of reactive oxygen species (ROS) in cells. The protein also has antimicrobial activity against a variety of bacteria by inducing bacterial membrane breakage.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 8kDa
Observed MW: 8kDa/10kDa/10kDa/8kDa/8kDa
UniProt Protein Name
Reactive oxygen species modulator 1
UniProt Gene Name
ROMO1
UniProt Synonym Gene Names
C20orf52; ROS modulator 1; MTGM
UniProt Entry Name
ROMO1_HUMAN

Similar Products

Product Notes

The ROMO1 romo1 (Catalog #AAA28622) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ROMO1 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ROMO1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA. WB: 1:500-1:1000 IF/ICC: 1:50-1:200 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the ROMO1 romo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPVAVGPYGQ SQPSCFDRVK MGFVMGCAVG MAAGALFGTF SCLRIGMRGR ELMGGIGKTM MQSGGTFGTF MAIGMGIRC. It is sometimes possible for the material contained within the vial of "ROMO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.