Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199586_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: RoraSample Type: Mouse Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Rora Polyclonal Antibody | anti-RORA antibody

Rora Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
Rora; sg; ROR1; ROR2; ROR3; Nr1f1; nmf267; tmgc26; staggerer; 9530021D13Rik
Reactivity
Cow, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Rora, Antibody; Rora Antibody - N-terminal region; anti-RORA antibody
Ordering
Host
Rabbit
Reactivity
Cow, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MESAPAAPDPAASEPGSSGSEAAAGSRETPLTQDTGRKSEAPGAGRRQSY
Sequence Length
523
Applicable Applications for anti-RORA antibody
WB (Western Blot)
Homology
Cow: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rora
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: RoraSample Type: Mouse Lung lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA199586_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: RoraSample Type: Mouse Lung lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: RORASample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

product-image-AAA199586_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: RORASample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: RORASample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

product-image-AAA199586_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: RORASample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Related Product Information for anti-RORA antibody
This is a rabbit polyclonal antibody against Rora. It was validated on Western Blot

Target Description: Rora is an orphan nuclear receptor. It binds DNA as a monomer to hormone response elements (HRE) containing a single core motif half-site preceded by a short A-T-rich sequence. This isomer binds to the consensus sequence 5'-[AT][TA]A[AT][CGT]TAGGTCA-3'. Regulates a number of genes involved in lipid metabolism such as apolipoproteins AI, APOA5, CIII, CYP71 and PPARgamma, in cerebellum and photoreceptor development including PCP2, OPN1SW, OPN1SM AND ARR3, in circadian rhythm with BMAL1, and skeletal muscle development with MYOD1. IT is a possible receptor for cholesterol or one of its derivatives.
Product Categories/Family for anti-RORA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
nuclear receptor ROR-alpha isoform 1
NCBI Official Synonym Full Names
RAR-related orphan receptor alpha
NCBI Official Symbol
Rora
NCBI Official Synonym Symbols
sg; ROR1; ROR2; ROR3; Nr1f1; nmf267; tmgc26; staggerer; 9530021D13Rik
NCBI Protein Information
nuclear receptor ROR-alpha
UniProt Protein Name
Nuclear receptor ROR-alpha
UniProt Gene Name
Rora
UniProt Synonym Gene Names
Nr1f1; Rzra
UniProt Entry Name
RORA_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RORA rora (Catalog #AAA199586) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Rora Antibody - N-terminal region reacts with Cow, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Rora can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RORA rora for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MESAPAAPDP AASEPGSSGS EAAAGSRETP LTQDTGRKSE APGAGRRQSY. It is sometimes possible for the material contained within the vial of "Rora, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.