Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198592_WB13.jpg WB (Western Blot) (WB Suggested Anti-RPLP0 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysateRPLP0 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit RPLP0 Polyclonal Antibody | anti-RPLP0 antibody

RPLP0 antibody - middle region

Gene Names
RPLP0; P0; LP0; L10E; RPP0; PRLP0
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
RPLP0, Antibody; RPLP0 antibody - middle region; anti-RPLP0 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY
Sequence Length
317
Applicable Applications for anti-RPLP0 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RPLP0
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RPLP0 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysateRPLP0 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

product-image-AAA198592_WB13.jpg WB (Western Blot) (WB Suggested Anti-RPLP0 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysateRPLP0 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

WB (Western Blot)

(Host: RabbitTarget Name: RPLP0Sample Tissue: Human HelaAntibody Dilution: 1.0ug/ml)

product-image-AAA198592_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: RPLP0Sample Tissue: Human HelaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RPLP0 antibody
This is a rabbit polyclonal antibody against RPLP0. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. The ribosomal protein is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2. The P0 protein can interact with P1 and P2 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2. The P0 protein can interact with P1 and P2 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. Transcript variants derived from alternative splicing exist; they encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Product Categories/Family for anti-RPLP0 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
60S acidic ribosomal protein P0
NCBI Official Synonym Full Names
ribosomal protein lateral stalk subunit P0
NCBI Official Symbol
RPLP0
NCBI Official Synonym Symbols
P0; LP0; L10E; RPP0; PRLP0
NCBI Protein Information
60S acidic ribosomal protein P0
UniProt Protein Name
60S acidic ribosomal protein P0
UniProt Gene Name
RPLP0
UniProt Entry Name
RLA0_HUMAN

Similar Products

Product Notes

The RPLP0 rplp0 (Catalog #AAA198592) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPLP0 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RPLP0 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RPLP0 rplp0 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PFSFGLVIQQ VFDNGSIYNP EVLDITEETL HSRFLEGVRN VASVCLQIGY. It is sometimes possible for the material contained within the vial of "RPLP0, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.