Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23472_WB8.jpg WB (Western Blot) (WB Suggested Anti-RPS14 Antibody Titration: 2.5ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

Rabbit RPS14 Polyclonal Antibody | anti-RPS14 antibody

RPS14 antibody - middle region

Gene Names
RPS14; S14; EMTB
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
RPS14, Antibody; RPS14 antibody - middle region; anti-RPS14 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL
Sequence Length
151
Applicable Applications for anti-RPS14 antibody
WB (Western Blot)
Homology
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RPS14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RPS14 Antibody Titration: 2.5ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

product-image-AAA23472_WB8.jpg WB (Western Blot) (WB Suggested Anti-RPS14 Antibody Titration: 2.5ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: RPS14Sample Type: MCF7Antibody Dilution: 1.0ug/mlRPS14 is supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA23472_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: RPS14Sample Type: MCF7Antibody Dilution: 1.0ug/mlRPS14 is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: RPS14Sample Type: JurkatAntibody Dilution: 1.0ug/mlRPS14 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA23472_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: RPS14Sample Type: JurkatAntibody Dilution: 1.0ug/mlRPS14 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: RPS14Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23472_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: RPS14Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: RPS14Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23472_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: RPS14Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: RPS14Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA23472_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: RPS14Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: RPS14Sample Type: HelaAntibody Dilution: 1.0ug/mlRPS14 is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA23472_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: RPS14Sample Type: HelaAntibody Dilution: 1.0ug/mlRPS14 is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: RPS14Sample Type: 721_BAntibody Dilution: 1.0ug/mlRPS14 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA23472_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: RPS14Sample Type: 721_BAntibody Dilution: 1.0ug/mlRPS14 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-RPS14 antibody
This is a rabbit polyclonal antibody against RPS14. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS14 is a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. In Chinese hamster ovary cells, mutations in this gene can lead to resistance to emetine, a protein synthesis inhibitor.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. In Chinese hamster ovary cells, mutations in this gene can lead to resistance to emetine, a protein synthesis inhibitor. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
40S ribosomal protein S14
NCBI Official Synonym Full Names
ribosomal protein S14
NCBI Official Symbol
RPS14
NCBI Official Synonym Symbols
S14; EMTB
NCBI Protein Information
40S ribosomal protein S14
UniProt Protein Name
40S ribosomal protein S14
UniProt Gene Name
RPS14
UniProt Entry Name
RS14_HUMAN

Similar Products

Product Notes

The RPS14 rps14 (Catalog #AAA23472) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPS14 antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RPS14 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RPS14 rps14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GNRTKTPGPG AQSALRALAR SGMKIGRIED VTPIPSDSTR RKGGRRGRRL. It is sometimes possible for the material contained within the vial of "RPS14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.