IHC (Immunohiostchemistry)
(Anti- RRM2 Picoband antibody, AAA46437, IHC(P)IHC(P): Human Mammary Cancer Tissue)
RRM2 Polyclonal Antibody | anti-RRM2 antibody
Anti-RRM2 Antibody
Gene Names
RRM2; R2; RR2; RR2M
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
RRM2, Antibody; Anti-RRM2 Antibody; Ribonucleoside-diphosphate reductase subunit M2; R2; Ribonucleotide reductase M2; Ribonucleotide reductase M2 polypeptide; Ribonucleotide reductase M2 subunit; Ribonucleotide reductase small chain; Ribonucleotide reductase small subunit; RIR2_HUMAN; RR2; RR2M; RRM2; ribonucleotide reductase M2; anti-RRM2 antibody
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
389
Applicable Applications for anti-RRM2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human RRM2 (1-33aa MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT), different from the related mouse and rat sequences by eight amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
IHC (Immunohiostchemistry)
(Anti- RRM2 Picoband antibody, AAA46437, IHC(P)IHC(P): Human Mammary Cancer Tissue)
IHC (Immunohiostchemistry)
(Anti- RRM2 Picoband antibody, AAA46437, IHC(P)IHC(P): Human Mammary Cancer Tissue)
WB (Western Blot)
(Anti- RRM2 Picoband antibody, AAA46437, Western blottingAll lanes: Anti RRM2 (AAA46437) at 0.5ug/mlLane 1: Rat Cardiac Muscle Tissue Lysate at 50ugLane 2: Mouse Cardiac Muscle Tissue Lysate at 50ugLane 3: A431 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 50KDObserved bind size: 50KD)
WB (Western Blot)
(Anti- RRM2 Picoband antibody, AAA46437, Western blottingAll lanes: Anti RRM2 (AAA46437) at 0.5ug/mlLane 1: Rat Cardiac Muscle Tissue Lysate at 50ugLane 2: Mouse Cardiac Muscle Tissue Lysate at 50ugLane 3: A431 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 50KDObserved bind size: 50KD)
Related Product Information for anti-RRM2 antibody
Description: Rabbit IgG polyclonal antibody for Ribonucleoside-diphosphate reductase subunit M2(RRM2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Background: Ribonucleoside-diphosphate reductase subunit M2, also known as ribonucleotide reductase small subunit, is an enzyme that in humans is encoded by the RRM2 gene. It is mapped to 2p25-p24. This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms which differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X.
Background: Ribonucleoside-diphosphate reductase subunit M2, also known as ribonucleotide reductase small subunit, is an enzyme that in humans is encoded by the RRM2 gene. It is mapped to 2p25-p24. This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms which differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X.
References
1. "Entrez Gene: ribonucleotide reductase M2". 2. Pavloff, N., Rivard, D., Masson, S., Shen, S.-H., Mes-Masson, A.-M. Sequence analysis of the large and small subunits of human ribonucleotide reductase. DNA Seq. 2: 227-234, 1992. 3. Yang-Feng, T. L., Thelander, L., Lewis, W. H., Srinivasan, P. R., Francke, U. Gene localization of the ribonucleotide reductase M2 subunit and of related and co-amplified sequences on human and mouse chromosomes. (Abstract) Am. J. Hum. Genet. 39: A174 only, 1986.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51,093 Da
NCBI Official Full Name
ribonucleoside-diphosphate reductase subunit M2 isoform 2
NCBI Official Synonym Full Names
ribonucleotide reductase regulatory subunit M2
NCBI Official Symbol
RRM2
NCBI Official Synonym Symbols
R2; RR2; RR2M
NCBI Protein Information
ribonucleoside-diphosphate reductase subunit M2
UniProt Protein Name
Ribonucleoside-diphosphate reductase subunit M2
UniProt Gene Name
RRM2
UniProt Synonym Gene Names
RR2
UniProt Entry Name
RIR2_HUMAN
Similar Products
Product Notes
The RRM2 rrm2 (Catalog #AAA46437) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-RRM2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RRM2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the RRM2 rrm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RRM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.