WB (Western Blot)
(WB Suggested Anti-RTCD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Rabbit RTCD1 Polyclonal Antibody | anti-RTCA antibody
RTCD1 antibody - N-terminal region
Gene Names
RTCA; RPC; RTC1; RTCD1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RTCD1, Antibody; RTCD1 antibody - N-terminal region; anti-RTCA antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIK
Sequence Length
366
Applicable Applications for anti-RTCA antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RTCD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-RTCD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
WB (Western Blot)
(WB Suggested Anti-RTCD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
WB (Western Blot)
(Host: RabbitTarget Name: RTCASample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: RTCASample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RTCA antibody
This is a rabbit polyclonal antibody against RTCD1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: RNA 3-prime-terminal phosphate cyclase catalyzes the ATP-dependent conversion of a 3-prime phosphate to a 2-prime,3-prime-cyclic phosphodiester at the end of RNA.RNA 3-prime-terminal phosphate cyclase (RPC; EC 6.5.1.4) catalyzes the ATP-dependent conversion of a 3-prime phosphate to a 2-prime,3-prime-cyclic phosphodiester at the end of RNA (Genschik et al., 1997 [PubMed 9184239]).[supplied by OMIM]. Sequence Note: removed 1 base from the 3' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1538 Y11651.1 1-1538
Target Description: RNA 3-prime-terminal phosphate cyclase catalyzes the ATP-dependent conversion of a 3-prime phosphate to a 2-prime,3-prime-cyclic phosphodiester at the end of RNA.RNA 3-prime-terminal phosphate cyclase (RPC; EC 6.5.1.4) catalyzes the ATP-dependent conversion of a 3-prime phosphate to a 2-prime,3-prime-cyclic phosphodiester at the end of RNA (Genschik et al., 1997 [PubMed 9184239]).[supplied by OMIM]. Sequence Note: removed 1 base from the 3' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1538 Y11651.1 1-1538
Product Categories/Family for anti-RTCA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
RNA 3'-terminal phosphate cyclase isoform b
NCBI Official Synonym Full Names
RNA 3'-terminal phosphate cyclase
NCBI Official Symbol
RTCA
NCBI Official Synonym Symbols
RPC; RTC1; RTCD1
NCBI Protein Information
RNA 3'-terminal phosphate cyclase
UniProt Protein Name
RNA 3'-terminal phosphate cyclase
UniProt Gene Name
RTCA
UniProt Synonym Gene Names
RPC; RPC1; RTC1; RTCD1; RNA cyclase; RNA-3'-phosphate cyclase; RTC domain-containing protein 1
Similar Products
Product Notes
The RTCA rtca (Catalog #AAA198673) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RTCD1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RTCD1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RTCA rtca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VQKIRAGRST PGLRPQHLSG LEMIRDLCDG QLEGAEIGST EITFTPEKIK. It is sometimes possible for the material contained within the vial of "RTCD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.