Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46029_AD13.jpg Application Data (Anti-RUNX2 Picoband antibody, AAA46029-2.jpgAll lanes: Anti RUNX2 (AAA46029) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: A431 Whole Cell Lysate at 40ugLane 3: K562 Whole Cell Lysate at 40ugLane 4: JURKAT Whole Cell Lysate at 40ugPredicted bind size: 56KDObserved bind size: 62KD)

Rabbit Runt-related transcription factor 2 Polyclonal Antibody | anti-RUNX2 antibody

Anti-RUNX2 Antibody

Average rating 0.0
No ratings yet
Gene Names
RUNX2; CCD; AML3; CCD1; CLCD; OSF2; CBFA1; OSF-2; PEA2aA; PEBP2aA; CBF-alpha-1
Reactivity
Human, Mouse. No cross reactivity with other proteins.
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
Runt-related transcription factor 2, Antibody; Anti-RUNX2 Antibody; Acute myeloid leukemia 3 protein antibody; Alpha subunit 1 antibody; AML3 antibody; CBF alpha 1 antibody; CBF-alpha-1 antibody; CBFA1 antibody; CCD antibody; CCD1 antibody; Cleidocranial dysplasia 1 antibody; Core binding factor antibody; Core binding factor runt domain alpha subunit 1 antibody; Core binding factor subunit alpha 1 antibody; Core-binding factor subunit alpha-1 antibody; MGC120022 antibody; MGC120023 antibody; Oncogene AML 3 antibody; Oncogene AML-3 antibody; OSF 2 antibody; OSF-2 antibody; OSF2 antibody; Osteoblast specific transcription factor 2 antibody; Osteoblast-specific transcription factor 2 antibody; OTTHUMP00000016533 antibody; PEA2 alpha A antibody; PEA2-alpha A antibody; PEA2aA antibody; PEBP2 alpha A antibody; PEBP2-alpha A antibody; PEBP2A1 antibody; PEBP2A2 antibody; PEBP2aA antibody; PEBP2aA1 antibody; Polyomavirus enhancer binding protein 2 alpha A subunit antibody; Polyomavirus enhancer-binding protein 2 alpha A subunit antibody; Runt domain antibody; Runt related transcription factor 2 antibody; Runt-related transcription factor 2 antibody; RUNX2 antibody; RUNX2_HUMAN antibody; SL3 3 enhancer factor 1 alpha A subunit antibody; SL3-3 enhancer factor 1 alpha A subunit antibody; SL3/AKV core binding factor alpha A subunit antibody; SL3/AKV core-binding factor alpha A subunit antibody; runt-related transcription factor 2; anti-RUNX2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse. No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
Sequence Length
499
Applicable Applications for anti-RUNX2 antibody
WB (Western Blot)
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Application Data

(Anti-RUNX2 Picoband antibody, AAA46029-2.jpgAll lanes: Anti RUNX2 (AAA46029) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: A431 Whole Cell Lysate at 40ugLane 3: K562 Whole Cell Lysate at 40ugLane 4: JURKAT Whole Cell Lysate at 40ugPredicted bind size: 56KDObserved bind size: 62KD)

product-image-AAA46029_AD13.jpg Application Data (Anti-RUNX2 Picoband antibody, AAA46029-2.jpgAll lanes: Anti RUNX2 (AAA46029) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: A431 Whole Cell Lysate at 40ugLane 3: K562 Whole Cell Lysate at 40ugLane 4: JURKAT Whole Cell Lysate at 40ugPredicted bind size: 56KDObserved bind size: 62KD)

Application Data

(Anti-RUNX2 Picoband antibody, AAA46029-1.jpgAll lanes: Anti RUNX2 (AAA46029) at 0.5ug/mlWB: Recombinant Human RUNX2 Protein 0.5ngPredicted bind size: 50KDObserved bind size: 50KD)

product-image-AAA46029_AD15.jpg Application Data (Anti-RUNX2 Picoband antibody, AAA46029-1.jpgAll lanes: Anti RUNX2 (AAA46029) at 0.5ug/mlWB: Recombinant Human RUNX2 Protein 0.5ngPredicted bind size: 50KDObserved bind size: 50KD)
Related Product Information for anti-RUNX2 antibody
Description: Rabbit IgG polyclonal antibody for Runt-related transcription factor 2(RUNX2) detection. Tested with WB in Human;Mouse.
Background: Core binding factor A1 (CBFA1/RUNX2) is a runt-like transcription factor essential for osteoblast differentiation. This protein is a member of the RUNX family of transcription factors and has a Runt DNA-binding domain. It is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. RUNX2 plays a non-redundant role for Cbfa1 in tooth development that may be distinct from that in bone formation. In odontogenesis, RUNX2 is not involved in the early signaling networks regulating tooth initiation and early morphogenesis but regulates key epithelial-mesenchymal interactions that control advancing morphogenesis and histodifferentiation of the epithelial enamel organ.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
860
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,249 Da
NCBI Official Full Name
runt-related transcription factor 2 isoform b
NCBI Official Synonym Full Names
runt-related transcription factor 2
NCBI Official Symbol
RUNX2
NCBI Official Synonym Symbols
CCD; AML3; CCD1; CLCD; OSF2; CBFA1; OSF-2; PEA2aA; PEBP2aA; CBF-alpha-1
NCBI Protein Information
runt-related transcription factor 2; PEA2-alpha A; PEBP2-alpha A; oncogene AML-3; acute myeloid leukemia 3 protein; SL3-3 enhancer factor 1 alpha A subunit; osteoblast-specific transcription factor 2; SL3/AKV core-binding factor alpha A subunit; core-binding factor, runt domain, alpha subunit 1; polyomavirus enhancer-binding protein 2 alpha A subunit
UniProt Protein Name
Runt-related transcription factor 2
UniProt Gene Name
RUNX2
UniProt Synonym Gene Names
AML3; CBFA1; OSF2; PEBP2A; CBF-alpha-1; OSF-2; PEA2-alpha A; PEBP2-alpha A
UniProt Entry Name
RUNX2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RUNX2 runx2 (Catalog #AAA46029) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-RUNX2 Antibody reacts with Human, Mouse. No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's Runt-related transcription factor 2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RUNX2 runx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Runt-related transcription factor 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.