Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281227_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse testis using S100A10 antibody at dilution of 1:100 (40x lens).)

Rabbit S100A10 Polyclonal Antibody | anti-S100A10 antibody

S100A10 Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
S100A10; 42C; P11; p10; GP11; ANX2L; CAL1L; CLP11; Ca[1]; ANX2LG
Reactivity
Human, Mouse, Rat, Monkey
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
S100A10, Antibody; S100A10 Polyclonal Antibody; 42C; ANX2L; ANX2LG; CAL1L; Ca[1]; CLP11; GP11; p10; P11; anti-S100A10 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat, Monkey
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Sequence Length
97
Applicable Applications for anti-S100A10 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human S100A10
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Positive Samples
HT-29, VERO, HeLa, A549, NIH/3T3
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse testis using S100A10 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281227_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse testis using S100A10 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human breast cancer using S100A10 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281227_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human breast cancer using S100A10 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded human colon using S100A10 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281227_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human colon using S100A10 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded rat ovary using S100A10 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281227_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded rat ovary using S100A10 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using S100A10 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

product-image-AAA281227_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using S100A10 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Related Product Information for anti-S100A10 antibody
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis.
Product Categories/Family for anti-S100A10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 11kDa
Observed: 11kDa
NCBI Official Full Name
protein S100-A10
NCBI Official Synonym Full Names
S100 calcium binding protein A10
NCBI Official Symbol
S100A10
NCBI Official Synonym Symbols
42C; P11; p10; GP11; ANX2L; CAL1L; CLP11; Ca[1]; ANX2LG
NCBI Protein Information
protein S100-A10
UniProt Protein Name
Protein S100-A10
UniProt Gene Name
S100A10
UniProt Synonym Gene Names
ANX2LG; CAL1L; CLP11

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The S100A10 s100a10 (Catalog #AAA281227) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The S100A10 Polyclonal Antibody reacts with Human, Mouse, Rat, Monkey and may cross-react with other species as described in the data sheet. AAA Biotech's S100A10 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the S100A10 s100a10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPSQMEHAME TMMFTFHKFA GDKGYLTKED LRVLMEKEFP GFLENQKDPL AVDKIMKDLD QCRDGKVGFQ SFFSLIAGLT IACNDYFVVH MKQKGKK. It is sometimes possible for the material contained within the vial of "S100A10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.