Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199043_WB13.jpg WB (Western Blot) (WB Suggested Anti-S100A3 Antibody Titration: 5.0ug/mlPositive Control: OVCAR-3 cell lysateS100A3 is supported by BioGPS gene expression data to be expressed in OVCAR3)

Rabbit S100A3 Polyclonal Antibody | anti-S100A3 antibody

S100A3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
S100A3; S100E
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
S100A3, Antibody; S100A3 antibody - N-terminal region; anti-S100A3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEF
Sequence Length
101
Applicable Applications for anti-S100A3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 82%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human S100A3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-S100A3 Antibody Titration: 5.0ug/mlPositive Control: OVCAR-3 cell lysateS100A3 is supported by BioGPS gene expression data to be expressed in OVCAR3)

product-image-AAA199043_WB13.jpg WB (Western Blot) (WB Suggested Anti-S100A3 Antibody Titration: 5.0ug/mlPositive Control: OVCAR-3 cell lysateS100A3 is supported by BioGPS gene expression data to be expressed in OVCAR3)

IHC (Immunohistochemistry)

(Rabbit Anti-S100A3 AntibodyParaffin Embedded Tissue: Human SkinCellular Data: Squamous epithelial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA199043_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-S100A3 AntibodyParaffin Embedded Tissue: Human SkinCellular Data: Squamous epithelial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-S100A3 antibody
This is a rabbit polyclonal antibody against S100A3. It was validated on Western Blot and immunohistochemistry

Target Description: S100A3 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown.The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
protein S100-A3
NCBI Official Synonym Full Names
S100 calcium binding protein A3
NCBI Official Symbol
S100A3
NCBI Official Synonym Symbols
S100E
NCBI Protein Information
protein S100-A3
UniProt Protein Name
Protein S100-A3
UniProt Gene Name
S100A3
UniProt Synonym Gene Names
S100E
UniProt Entry Name
S10A3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The S100A3 s100a3 (Catalog #AAA199043) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The S100A3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's S100A3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the S100A3 s100a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MARPLEQAVA AIVCTFQEYA GRCGDKYKLC QAELKELLQK ELATWTPTEF. It is sometimes possible for the material contained within the vial of "S100A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.