WB (Western Blot)
(WB Suggested Anti-SAA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Stomach)
Rabbit SAA4 Polyclonal Antibody | anti-SAA4 antibody
SAA4 antibody - middle region
Gene Names
SAA4; CSAA; C-SAA
Reactivity
HumanPredicted Reactivity: Cow, Guinea Pig, Human, Mouse, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SAA4, Antibody; SAA4 antibody - middle region; anti-SAA4 antibody
Host
Rabbit
Reactivity
Human
Predicted Reactivity: Cow, Guinea Pig, Human, Mouse, Pig
Predicted Reactivity: Cow, Guinea Pig, Human, Mouse, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 0.5-1 mg/ml. (varies by lot)
Sequence
Synthetic peptide located within the following region: RVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKK
Sequence Length
130
Applicable Applications for anti-SAA4 antibody
WB (Western Blot)
Homology
Cow: 85%; Guinea Pig: 79%; Human: 100%; Mouse: 77%; Pig: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SAA4
Replacement Item
This antibody may replace item sc-169237 from Santa Cruz Biotechnology.
Protein Size(# aa)
130 amino acids
Protein Interactions
COL4A1; NUDT9P1
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-SAA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Stomach)
WB (Western Blot)
(WB Suggested Anti-SAA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Stomach)
Related Product Information for anti-SAA4 antibody
This is a rabbit polyclonal antibody against SAA4. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SAA4 is a major acute phase reactant. It is an Apolipoprotein of the HDL complex.
Target Description: SAA4 is a major acute phase reactant. It is an Apolipoprotein of the HDL complex.
Product Categories/Family for anti-SAA4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
2kDa
NCBI Official Full Name
serum amyloid A-4 protein
NCBI Official Synonym Full Names
serum amyloid A4, constitutive
NCBI Official Symbol
SAA4
NCBI Official Synonym Symbols
CSAA; C-SAA
NCBI Protein Information
serum amyloid A-4 protein
UniProt Protein Name
Serum amyloid A-4 protein
UniProt Gene Name
SAA4
UniProt Synonym Gene Names
CSAA; C-SAA
UniProt Entry Name
SAA4_HUMAN
Similar Products
Product Notes
The SAA4 saa4 (Catalog #AAA199094) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SAA4 antibody - middle region reacts with Human Predicted Reactivity: Cow, Guinea Pig, Human, Mouse, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's SAA4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SAA4 saa4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RVYLQGLIDY YLFGNSSTVL EDSKSNEKAE EWGRSGKDPD RFRPDGLPKK. It is sometimes possible for the material contained within the vial of "SAA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.