Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281815_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using SCAMP2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit SCAMP2 Polyclonal Antibody | anti-SCAMP2 antibody

SCAMP2 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
SCAMP2; SCAMP2
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
SCAMP2, Antibody; SCAMP2 Rabbit pAb; SCAMP2; anti-SCAMP2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKML
Applicable Applications for anti-SCAMP2 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of human SCAMP2 (NP_005688.2).
Positive Samples
HeLa, A-431
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using SCAMP2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281815_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using SCAMP2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using SCAMP2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281815_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using SCAMP2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using SCAMP2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281815_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using SCAMP2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using SCAMP2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA281815_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using SCAMP2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-SCAMP2 antibody
Background: This gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that the SCAMPs may function at the same site during vesicular transport rather than in separate pathways. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,649 Da
NCBI Official Full Name
secretory carrier-associated membrane protein 2
NCBI Official Synonym Full Names
secretory carrier membrane protein 2
NCBI Official Symbol
SCAMP2
NCBI Official Synonym Symbols
SCAMP2
NCBI Protein Information
secretory carrier-associated membrane protein 2; OTTHUMP00000183476
UniProt Protein Name
Secretory carrier-associated membrane protein 2
UniProt Gene Name
SCAMP2
UniProt Entry Name
SCAM2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SCAMP2 scamp2 (Catalog #AAA281815) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SCAMP2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SCAMP2 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the SCAMP2 scamp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSAFDTNPFA DPVDVNPFQD PSVTQLTNAP QGGLAEFNPF SETNAATTVP VTQLPGSSQP AVLQPSVEPT QPTPQAVVSA AQAGLLRQQE ELDRKAAELE RKERELQNTV ANLHVRQNNW PPLPSWCPVK PCFYQDFSTE IPADYQRICK ML. It is sometimes possible for the material contained within the vial of "SCAMP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.