Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283274_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of MCF7 cells using [KD Validated] SCD Rabbit pAb(AAA283274) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit anti-Human SCD Polyclonal Antibody | anti-SCD antibody

[KD Validated] SCD Rabbit pAb

Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
SCD, Antibody; [KD Validated] SCD Rabbit pAb; SCD1; FADS5; SCDOS; hSCD1; MSTP008; SCD; anti-SCD antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Sequence
ATWLVNSAAHLFGYRPYDKNISPRENILVSLGAVGEGFHNYHHSFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAILARIKRTGDGNYKSG
Applicable Applications for anti-SCD antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Cross Reactivity
Human, Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 260-359 of human SCD(NP_005054.3).
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.09% Sodium azide,50% glycerol,pH7.3.

IF (Immunofluorescence)

(Immunofluorescence analysis of MCF7 cells using [KD Validated] SCD Rabbit pAb(AAA283274) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA283274_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of MCF7 cells using [KD Validated] SCD Rabbit pAb(AAA283274) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of Hep G2 cells using [KD Validated] SCD Rabbit pAb(AAA283274) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA283274_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of Hep G2 cells using [KD Validated] SCD Rabbit pAb(AAA283274) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse liver using [KD Validated] SCD Rabbit pAb (AAA283274) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

product-image-AAA283274_WB13.jpg WB (Western Blot) (Western blot analysis of lysates from Mouse liver using [KD Validated] SCD Rabbit pAb (AAA283274) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of lysates from wild type (WT) and SCD knockdown (KD) Hep G2 cells using [KD Validated] SCD Rabbit pAb (AAA283274) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

product-image-AAA283274_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from wild type (WT) and SCD knockdown (KD) Hep G2 cells using [KD Validated] SCD Rabbit pAb (AAA283274) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Related Product Information for anti-SCD antibody
This gene encodes an enzyme involved in fatty acid biosynthesis, primarily the synthesis of oleic acid. The protein belongs to the fatty acid desaturase family and is an integral membrane protein located in the endoplasmic reticulum. Transcripts of approximately 3.9 and 5.2 kb, differing only by alternative polyadenlyation signals, have been detected. A gene encoding a similar enzyme is located on chromosome 4 and a pseudogene of this gene is located on chromosome 17.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 42kDa
Observed MW: 37kDa
UniProt Protein Name
Acyl-CoA desaturase
UniProt Gene Name
SCD
UniProt Synonym Gene Names
Delta-9 desaturase
UniProt Entry Name
ACOD_HUMAN

Similar Products

Product Notes

The SCD scd (Catalog #AAA283274) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KD Validated] SCD Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SCD can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the SCD scd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ATWLVNSAAH LFGYRPYDKN ISPRENILVS LGAVGEGFHN YHHSFPYDYS ASEYRWHINF TTFFIDCMAA LGLAYDRKKV SKAAILARIK RTGDGNYKSG. It is sometimes possible for the material contained within the vial of "SCD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.