Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201594_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: SDC1Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SDC1 Polyclonal Antibody | anti-SDC1 antibody

SDC1 Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SDC1; SDC; CD138; SYND1; syndecan
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SDC1, Antibody; SDC1 Antibody - N-terminal region; anti-SDC1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: LWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDI
Sequence Length
310
Applicable Applications for anti-SDC1 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SDC1
Protein Size (# AA)
310 amino acids
Blocking Peptide
For anti-SDC1 (MBS3221296) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: SDC1Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)

product-image-AAA201594_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: SDC1Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SDC1 antibody
The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. The syndecan-1 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered syndecan-1 expression has been detected in several different tumor types. While several transcript variants may exist for this gene, the full-length natures of only two have been described to date. These two represent the major variants of this gene and encode the same protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
syndecan-1
NCBI Official Synonym Full Names
syndecan 1
NCBI Official Symbol
SDC1
NCBI Official Synonym Symbols
SDC; CD138; SYND1; syndecan
NCBI Protein Information
syndecan-1
UniProt Protein Name
Syndecan-1
UniProt Gene Name
SDC1
UniProt Synonym Gene Names
SDC; SYND1
UniProt Entry Name
SDC1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SDC1 sdc1 (Catalog #AAA201594) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SDC1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SDC1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SDC1 sdc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LWLWLCALAL SLQPALPQIV ATNLPPEDQD GSGDDSDNFS GSGAGALQDI. It is sometimes possible for the material contained within the vial of "SDC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.