Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA224285_IHC11.jpg IHC (Immunohistochemisry) (SDF2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

Rabbit SDF2 Polyclonal Antibody | anti-SDF2 antibody

SDF2 antibody

Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
SDF2, Antibody; SDF2 antibody; Polyclonal SDF2; Anti-SDF2; Stromal Cell-Derived Factor 2; SDF-2; SDF 2; SDF2; anti-SDF2 antibody
Ordering
Host
Rabbit
Clonality
Polyclonal
Specificity
SDF2 antibody was raised against the N terminal of SDF2
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SDF2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
211
Applicable Applications for anti-SDF2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
SDF2 is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.
Cross-Reactivity
Human, Mouse, Rat
Immunogen
SDF2 antibody was raised using the N terminal of SDF2 corresponding to a region with amino acids KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

IHC (Immunohistochemisry)

(SDF2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

product-image-AAA224285_IHC11.jpg IHC (Immunohistochemisry) (SDF2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

WB (Western Blot)

(SDF2 antibody (AAA224285) used at 1.25 ug/ml to detect target protein.)

product-image-AAA224285_WB13.jpg WB (Western Blot) (SDF2 antibody (AAA224285) used at 1.25 ug/ml to detect target protein.)

IHC (Immunohistochemistry)

(SDF2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X)

product-image-AAA224285_IHC15.jpg IHC (Immunohistochemistry) (SDF2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X)
Related Product Information for anti-SDF2 antibody
Rabbit polyclonal SDF2 antibody raised against the N terminal of SDF2
Product Categories/Family for anti-SDF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
21 kDa (MW of target protein)
NCBI Official Full Name
SDF2
UniProt Protein Name
SDF2 protein
UniProt Gene Name
SDF2
UniProt Entry Name
Q6IBU4_HUMAN

Similar Products

Product Notes

The SDF2 sdf2 (Catalog #AAA224285) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SDF2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SDF2 sdf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SDF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.