Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200239_WB13.jpg WB (Western Blot) (WB Suggested Anti-SEC23IP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateSEC23IP is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Rabbit SEC23IP Polyclonal Antibody | anti-SEC23IP antibody

SEC23IP antibody - N-terminal region

Gene Names
SEC23IP; P125; P125A; MSTP053
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SEC23IP, Antibody; SEC23IP antibody - N-terminal region; anti-SEC23IP antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VPFIPVTQASASPASLLLPGEDSTDVGEEDSFLGQTSIHTSAPQTFSYFS
Sequence Length
1000
Applicable Applications for anti-SEC23IP antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SEC23IP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SEC23IP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateSEC23IP is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

product-image-AAA200239_WB13.jpg WB (Western Blot) (WB Suggested Anti-SEC23IP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateSEC23IP is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

WB (Western Blot)

(Host: RabbitTarget Name: SEC23IPSample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200239_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: SEC23IPSample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-SEC23IP antibody
This is a rabbit polyclonal antibody against SEC23IP. It was validated on Western Blot

Target Description: COPII-coated vesicles are involved in protein transport from the endoplasmic reticulum to the Golgi apparatus. The protein encoded by this gene was identified by its interaction with a mouse protein similar to yeast Sec23p, an essential component of the COPII. This protein shares significant similarity with phospholipid-modifying proteins, especially phosphatidic acid preferring-phospholipase A1. Overexpression of this protein has been shown to cause disorganization of the endoplasmic reticulum-Golgi intermediate compartment and Golgi apparatus, which suggests its role in the early secretory pathway.
Product Categories/Family for anti-SEC23IP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
111kDa
NCBI Official Full Name
SEC23-interacting protein
NCBI Official Synonym Full Names
SEC23 interacting protein
NCBI Official Symbol
SEC23IP
NCBI Official Synonym Symbols
P125; P125A; MSTP053
NCBI Protein Information
SEC23-interacting protein
UniProt Protein Name
SEC23-interacting protein
UniProt Gene Name
SEC23IP
UniProt Entry Name
S23IP_HUMAN

Similar Products

Product Notes

The SEC23IP sec23ip (Catalog #AAA200239) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEC23IP antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SEC23IP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SEC23IP sec23ip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VPFIPVTQAS ASPASLLLPG EDSTDVGEED SFLGQTSIHT SAPQTFSYFS. It is sometimes possible for the material contained within the vial of "SEC23IP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.