Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281593_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using SEC61B antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit SEC61B Polyclonal Antibody | anti-SEC61B antibody

[KO Validated] SEC61B Rabbit pAb

Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
SEC61B, Antibody; [KO Validated] SEC61B Rabbit pAb; SEC61B; anti-SEC61B antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
Applicable Applications for anti-SEC61B antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-96 of human SEC61B (NP_006799.1).
Cellular Location
Endoplasmic reticulum membrane, Single-pass membrane protein
Positive Samples
HeLa, HepG2, SH-SY5Y, Mouse stomach, Rat liver, Rat stomach
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using SEC61B antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281593_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using SEC61B antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using SEC61B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)

product-image-AAA281593_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using SEC61B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)

WB (Western Blot)

(Western blot analysis of extracts from normal (control) and SEC61B knockout (KO) 293T cells, using SEC61B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA281593_WB15.jpg WB (Western Blot) (Western blot analysis of extracts from normal (control) and SEC61B knockout (KO) 293T cells, using SEC61B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-SEC61B antibody
Background: The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the beta-subunit protein. The Sec61 subunits are also observed in the post-ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript.
Product Categories/Family for anti-SEC61B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
96
NCBI Official Full Name
Protein transport protein Sec61 subunit beta
NCBI Official Synonym Full Names
Sec61 beta subunit
NCBI Official Symbol
SEC61B
NCBI Protein Information
protein transport protein Sec61 subunit beta; Sec61 complex, beta subunit; protein translocation complex beta; protein transport protein SEC61 beta subunit
UniProt Protein Name
Protein transport protein Sec61 subunit beta
UniProt Gene Name
SEC61B
UniProt Entry Name
SC61B_HUMAN

Similar Products

Product Notes

The SEC61B sec61b (Catalog #AAA281593) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] SEC61B Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SEC61B can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the SEC61B sec61b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPGPTPSGTN VGSSGRSPSK AVAARAAGST VRQRKNASCG TRSAGRTTSA GTGGMWRFYT EDSPGLKVGP VPVLVMSLLF IASVFMLHIW GKYTRS. It is sometimes possible for the material contained within the vial of "SEC61B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.