Rabbit SECTM1 Polyclonal Antibody | anti-SECTM1 antibody
SECTM1 antibody - middle region
Gene Names
SECTM1; K12; SECTM
Reactivity
Tested Reactivity: HumanPredicted Reactivity: Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SECTM1, Antibody; SECTM1 antibody - middle region; anti-SECTM1 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human
Predicted Reactivity: Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
ARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAV
Applicable Applications for anti-SECTM1 antibody
WB (Western Blot)
Protein Size (# AA)
248 amino acids
Protein Interactions
UBC; CD7;
Blocking Peptide
For anti-SECTM1 antibody
Predicted Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SECTM1
Replacement Item
This antibody may replace item sc-139364 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-SECTM1 antibody
This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.
Product Categories/Family for anti-SECTM1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
secreted and transmembrane protein 1
NCBI Official Synonym Full Names
secreted and transmembrane 1
NCBI Official Symbol
SECTM1
NCBI Official Synonym Symbols
K12; SECTM
NCBI Protein Information
secreted and transmembrane protein 1
UniProt Protein Name
Secreted and transmembrane protein 1
UniProt Gene Name
SECTM1
UniProt Synonym Gene Names
K12
Similar Products
Product Notes
The SECTM1 sectm1 (Catalog #AAA23520) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SECTM1 antibody - middle region reacts with Tested Reactivity: Human Predicted Reactivity: Human and may cross-react with other species as described in the data sheet. AAA Biotech's SECTM1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SECTM1 sectm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ARDSHAGLYM WHLVGHQRNN RQVTLEVSGA EPQSAPDTGF WPVPAVVTAV. It is sometimes possible for the material contained within the vial of "SECTM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
