Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199903_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: sep15Sample Type: Rat Thymus lysatesAntibody Dilution: 1.0ug/ml)

Rabbit SELENOF Polyclonal Antibody | anti-SELENOF antibody

SELENOF Antibody - C-terminal region

Gene Names
Selenof; Sep15
Reactivity
Tested Species Reactivity: Rat
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Pig, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SELENOF, Antibody; SELENOF Antibody - C-terminal region; anti-SELENOF antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Rat
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Pig, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: LFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLER
Sequence Length
162
Applicable Applications for anti-SELENOF antibody
WB (Western Blot)
Protein Size (#AA)
162 amino acids
Predicted Homology
Cow: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat sep15
Protein Interaction
Rpl30
Blocking Peptide
For anti-SELENOF (MBS3208942) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: sep15Sample Type: Rat Thymus lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA199903_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: sep15Sample Type: Rat Thymus lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SELENOF antibody
Description: The protein encoded by this gene belongs to the SEP15/selenoprotein M family. The exact function of this protein is not known; however, it has been found to associate with UDP-glucose:glycoprotein glucosyltransferase (UGTR), an endoplasmic reticulum(ER)-resident protein, which is involved in the quality control of protein folding. The association with UGTR retains this protein in the ER, where it may play a role in protein folding. Knockout studies in mice also suggest a role for this gene in cataract formation and colon carcinogenesis. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec). Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal.
Product Categories/Family for anti-SELENOF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
selenoprotein F
NCBI Official Synonym Full Names
selenoprotein F
NCBI Official Symbol
Selenof
NCBI Official Synonym Symbols
Sep15
NCBI Protein Information
selenoprotein F
UniProt Protein Name
Selenoprotein F
UniProt Gene Name
Selenof

Similar Products

Product Notes

The SELENOF selenof (Catalog #AAA199903) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SELENOF Antibody - C-terminal region reacts with Tested Species Reactivity: Rat Predicted Species Reactivity: Human, Mouse, Rat, Cow, Pig, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SELENOF can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SELENOF selenof for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LFRGLQIKYV RGSDPVLKLL DDNGNIAEEL SILKWNTDSV EEFLSEKLER. It is sometimes possible for the material contained within the vial of "SELENOF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.