Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199044_WB10.jpg WB (Western Blot) (WB Suggested Anti-SEMG1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Rabbit anti-Human, Pig SEMG1 Polyclonal Antibody | anti-SEMG1 antibody

SEMG1 antibody - N-terminal region

Gene Names
SEMG1; SGI; SEMG; CT103; dJ172H20.2
Reactivity
Human, Pig
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
SEMG1, Antibody; SEMG1 antibody - N-terminal region; anti-SEMG1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHL
Sequence Length
462
Applicable Applications for anti-SEMG1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%; Pig: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SEMG1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SEMG1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

product-image-AAA199044_WB10.jpg WB (Western Blot) (WB Suggested Anti-SEMG1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: SEMG1Sample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)

product-image-AAA199044_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: SEMG1Sample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)

IHC (Immunohiostchemistry)

(Rabbit Anti-SEMG1 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA199044_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-SEMG1 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-SEMG1 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA199044_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-SEMG1 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-SEMG1 antibody
This is a rabbit polyclonal antibody against SEMG1. It was validated on Western Blot and immunohistochemistry

Target Description: SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely.The protein encoded by this gene is the predominant protein in semen. The encoded secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
semenogelin-1 preproprotein
NCBI Official Synonym Full Names
semenogelin 1
NCBI Official Symbol
SEMG1
NCBI Official Synonym Symbols
SGI; SEMG; CT103; dJ172H20.2
NCBI Protein Information
semenogelin-1
UniProt Protein Name
Semenogelin-1
UniProt Gene Name
SEMG1
UniProt Synonym Gene Names
SEMG; SGI
UniProt Entry Name
SEMG1_HUMAN

Similar Products

Product Notes

The SEMG1 semg1 (Catalog #AAA199044) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEMG1 antibody - N-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's SEMG1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SEMG1 semg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QKGKQQTESK GSFSIQYTYH VDANDHDQSR KSQQYDLNAL HKTTKSQRHL. It is sometimes possible for the material contained within the vial of "SEMG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.