Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200106_WB13.jpg WB (Western Blot) (WB Suggested Anti-SENP6 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateSENP6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit SENP6 Polyclonal Antibody | anti-SENP6 antibody

SENP6 antibody - C-terminal region

Gene Names
SENP6; SSP1; SUSP1
Reactivity
Cow, Horse, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SENP6, Antibody; SENP6 antibody - C-terminal region; anti-SENP6 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MNLANWFPPPRMRTKREEIRNIILKLQEDQSKEKRKHKDTYSTEAPLGEG
Sequence Length
1105
Applicable Applications for anti-SENP6 antibody
WB (Western Blot)
Homology
Cow: 79%; Horse: 79%; Human: 100%; Pig: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SENP6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SENP6 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateSENP6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA200106_WB13.jpg WB (Western Blot) (WB Suggested Anti-SENP6 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateSENP6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

WB (Western Blot)

(Sample Type: RatSample Type: 1.Rat Testis cells (200ug) Primary Dilution: 1:1000Secondary Antibody: alkaline phosphatase-conjugated anti-rabbitSecondary Dilution: 1:1000Image Submitted by: Andreia CarvalhoIBMC-OBF, Portugal See Customer Feedback tab for detailed information.)

product-image-AAA200106_WB15.jpg WB (Western Blot) (Sample Type: RatSample Type: 1.Rat Testis cells (200ug) Primary Dilution: 1:1000Secondary Antibody: alkaline phosphatase-conjugated anti-rabbitSecondary Dilution: 1:1000Image Submitted by: Andreia CarvalhoIBMC-OBF, Portugal See Customer Feedback tab for detailed information.)
Related Product Information for anti-SENP6 antibody
This is a rabbit polyclonal antibody against SENP6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SENP6 is a UBL-specific protease that deconjugates SUMO1, SUMO2 and SUMO3 from targeted proteins. It does not seem to be involved in the processing of full-length SUMO proteins to their mature forms. SENP6 deconjugates SUMO1 from RXRA, leading to transcriptional activation. It may act preferentially on substrates containing 3 or more SUMO2 or SUMO3 moieties.Ubiquitin-like molecules (UBLs), such as SUMO1 (UBL1; MIM 601912), are structurally related to ubiquitin (MIM 191339) and can be ligated to target proteins in a similar manner as ubiquitin. However, covalent attachment of UBLs does not result in degradation of the modified proteins. SUMO1 modification is implicated in the targeting of RANGAP1 (MIM 602362) to the nuclear pore complex, as well as in stabilization of I-kappa-B-alpha (NFKBIA; MIM 164008) from degradation by the 26S proteasome. Like ubiquitin, UBLs are synthesized as precursor proteins, with 1 or more amino acids following the C-terminal glycine-glycine residues of the mature UBL protein. Thus, the tail sequences of the UBL precursors need to be removed by UBL-specific proteases, such as SENP6, prior to their conjugation to target proteins (Kim et al., 2000 [PubMed 10799485]).[supplied by OMIM].
Product Categories/Family for anti-SENP6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
125kDa
NCBI Official Full Name
sentrin-specific protease 6 isoform 2
NCBI Official Synonym Full Names
SUMO specific peptidase 6
NCBI Official Symbol
SENP6
NCBI Official Synonym Symbols
SSP1; SUSP1
NCBI Protein Information
sentrin-specific protease 6
UniProt Protein Name
Sentrin-specific protease 6
UniProt Gene Name
SENP6
UniProt Synonym Gene Names
KIAA0797; SSP1; SUSP1
UniProt Entry Name
SENP6_HUMAN

Similar Products

Product Notes

The SENP6 senp6 (Catalog #AAA200106) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SENP6 antibody - C-terminal region reacts with Cow, Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's SENP6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SENP6 senp6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MNLANWFPPP RMRTKREEIR NIILKLQEDQ SKEKRKHKDT YSTEAPLGEG. It is sometimes possible for the material contained within the vial of "SENP6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.