Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200689_WB8.jpg WB (Western Blot) (WB Suggested Anti-SEPT11(septin 11) Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)

Rabbit SEPT11 Polyclonal Antibody | anti-SEPT11 antibody

SEPT11 Antibody - N-terminal region

Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SEPT11, Antibody; SEPT11 Antibody - N-terminal region; anti-SEPT11 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET
Sequence Length
429
Applicable Applications for anti-SEPT11 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT11(septin 11)
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SEPT11(septin 11) Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)

product-image-AAA200689_WB8.jpg WB (Western Blot) (WB Suggested Anti-SEPT11(septin 11) Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: SEPT11Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA200689_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: SEPT11Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SEPT11Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA200689_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: SEPT11Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Sample Type: Human NT-2, mouse brainSample Type: 1. Human NT-2 cells (60ug)2. mouse brain extracts (80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)

product-image-AAA200689_WB13.jpg WB (Western Blot) (Sample Type: Human NT-2, mouse brainSample Type: 1. Human NT-2 cells (60ug)2. mouse brain extracts (80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human Spleen lysate tissue at an antibody concentration of 5.0ug/ml using anti-SEPT11(septin 11) antibody)

product-image-AAA200689_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Human Spleen lysate tissue at an antibody concentration of 5.0ug/ml using anti-SEPT11(septin 11) antibody)
Related Product Information for anti-SEPT11 antibody
This is a rabbit polyclonal antibody against SEPT11. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SEPT11 belongs to the conserved septin family of filament-forming cytoskeletal GTPases that are involved in a variety of cellular functions including cytokinesis and vesicle trafficking.
Product Categories/Family for anti-SEPT11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
septin-11 isoform 2
NCBI Official Synonym Full Names
septin 11
NCBI Official Symbol
SEPT11
NCBI Protein Information
septin-11
UniProt Protein Name
Septin-11
UniProt Gene Name
SEPT11
UniProt Entry Name
SEP11_HUMAN

Similar Products

Product Notes

The SEPT11 sept11 (Catalog #AAA200689) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEPT11 Antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SEPT11 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SEPT11 sept11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAVAVGRPSN EELRNLSLSG HVGFDSLPDQ LVNKSTSQGF CFNILCVGET. It is sometimes possible for the material contained within the vial of "SEPT11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.