Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA224173_WB8.jpg WB (Western Blot) (Tissue analyzed: Human Fetal Heart; Antibody Dilution: 1.0ug/ml)

Rabbit Sequestosome 1 Polyclonal Antibody | anti-SQSTM1 antibody

Sequestosome 1 antibody

Average rating 0.0
No ratings yet
Gene Names
SQSTM1; p60; p62; A170; OSIL; PDB3; ZIP3; p62B; FTDALS3
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
Sequestosome 1, Antibody; Sequestosome 1 antibody; Polyclonal Sequestosome 1; Anti-Sequestosome 1; Sequestosome -1; p60; p62B; OSIL; PDB3; ZIP3; SQSTM1; Sequestosome 1; A170; p62; anti-SQSTM1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
Sequestosome 1 antibody was raised against the middle region of SQSTM1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SQSTM1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
440
Applicable Applications for anti-SQSTM1 antibody
WB (Western Blot)
Biological Significance
This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
Sequestosome 1 antibody was raised using the middle region of SQSTM1 corresponding to a region with amino acids EEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQE
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

WB (Western Blot)

(Tissue analyzed: Human Fetal Heart; Antibody Dilution: 1.0ug/ml)

product-image-AAA224173_WB8.jpg WB (Western Blot) (Tissue analyzed: Human Fetal Heart; Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Tissue analyzed: Human Fetal Liver; Antibody Dilution: 1.0ug/ml)

product-image-AAA224173_WB10.jpg WB (Western Blot) (Tissue analyzed: Human Fetal Liver; Antibody Dilution: 1.0ug/ml)

IHC (Immunohistochemisry)

(Pancreas)

product-image-AAA224173_IHC11.jpg IHC (Immunohistochemisry) (Pancreas)

WB (Western Blot)

(Tissue analyzed: Human Fetal Lung; Antibody Dilution: 1.0ug/ml)

product-image-AAA224173_WB13.jpg WB (Western Blot) (Tissue analyzed: Human Fetal Lung; Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Recommended SQSTM1 Antibody Titration: 0.2-1 ug/ml)

product-image-AAA224173_WB15.jpg WB (Western Blot) (Recommended SQSTM1 Antibody Titration: 0.2-1 ug/ml)
Related Product Information for anti-SQSTM1 antibody
Rabbit polyclonal Sequestosome 1 antibody raised against the middle region of SQSTM1
Product Categories/Family for anti-SQSTM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
48 kDa (MW of target protein)
NCBI Official Full Name
Sequestosome 1
NCBI Official Synonym Full Names
sequestosome 1
NCBI Official Symbol
SQSTM1
NCBI Official Synonym Symbols
p60; p62; A170; OSIL; PDB3; ZIP3; p62B; FTDALS3
NCBI Protein Information
sequestosome-1
UniProt Protein Name
Sequestosome-1
UniProt Gene Name
SQSTM1
UniProt Synonym Gene Names
ORCA; OSIL; EBIAP; p60
UniProt Entry Name
SQSTM_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SQSTM1 sqstm1 (Catalog #AAA224173) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Sequestosome 1 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Sequestosome 1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SQSTM1 sqstm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Sequestosome 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.